PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G176677_P04
Common Namepco143489(612)
Organism
Zea mays
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NAC
Protein Properties Length: 168aa    MW: 19483.4 Da    PI: 9.7086
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G176677_P04genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.56.7e-5061341129
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                        lppGfrFhPtd el v+yLk+k+ gk+l++ ++i+e+d+yk+ PwdLp+  ++++++  wyfF++rd+ky++g r+nr+t  gyWkatgkd+
  GRMZM2G176677_P04   6 LPPGFRFHPTDVELTVYYLKRKLLGKHLRC-NAITEIDLYKFAPWDLPEraSLESNDLVWYFFCPRDRKYSSGLRTNRSTGVGYWKATGKDR 96 
                        79****************************.89***************52355556669********************************* PP

                NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                        +v+  ++++vg+k+tLvf+ g+ p+g +tdWvm eyrle
  GRMZM2G176677_P04  97 PVVY-NSRTVGMKRTLVFHLGKPPRGDRTDWVMYEYRLE 134
                        ****.999*****************************85 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-573143IPR003441NAC domain
PROSITE profilePS5100552.8696159IPR003441NAC domain
PfamPF023655.6E-277133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007264Biological Processsmall GTPase mediated signal transduction
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005525Molecular FunctionGTP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MAKTSLPPGF RFHPTDVELT VYYLKRKLLG KHLRCNAITE IDLYKFAPWD LPERASLESN  60
DLVWYFFCPR DRKYSSGLRT NRSTGVGYWK ATGKDRPVVY NSRTVGMKRT LVFHLGKPPR  120
GDRTDWVMYE YRLEDEEIAA SGVKLADYSD LAVCSSYIEA WKLTKPSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-52213311140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.660360.0ear| endosperm| glume| meristem| ovary| pollen| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G176677
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the epidermal cells of the root apical region. {ECO:0000269|PubMed:20388856}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G176677_P04
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0683710.0BT068371.1 Zea mays full-length cDNA clone ZM_BFb0135E15 mRNA, complete cds.
GenBankBT0685320.0BT068532.1 Zea mays full-length cDNA clone ZM_BFb0292O13 mRNA, complete cds.
GenBankBT0839010.0BT083901.1 Zea mays full-length cDNA clone ZM_BFb0052I14 mRNA, complete cds.
GenBankKJ7279520.0KJ727952.1 Zea mays clone pUT6050 NAC transcription factor (NAC120) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001169920.11e-104uncharacterized protein LOC100383817
RefseqXP_008668454.11e-104ras-related protein18A1 isoform X1
SwissprotQ9FY824e-61NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A1D6E5L91e-103A0A1D6E5L9_MAIZE; Ras-related protein18A1
TrEMBLA0A3L6FRF81e-102A0A3L6FRF8_MAIZE; NAC domain-containing protein 82
TrEMBLC0PJA21e-102C0PJA2_MAIZE; NAC transcription factor
STRINGGRMZM2G176677_P011e-103(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.42e-63NAC domain containing protein 82
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]