PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G171650_P04 | ||||||||
Common Name | LOC100272251 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 65aa MW: 7364.62 Da PI: 10.9711 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 83.2 | 1.6e-26 | 11 | 60 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+k rqv fskRr+g++KKA+EL LCdaeva+++fs+ gklyeyss GRMZM2G171650_P04 11 RIEDKASRQVRFSKRRAGLFKKAFELALLCDAEVALLVFSPGGKLYEYSS 60 8***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-32 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.623 | 2 | 62 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.86E-34 | 4 | 63 | No hit | No description |
SuperFamily | SSF55455 | 7.33E-27 | 4 | 62 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-27 | 4 | 24 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.6E-26 | 11 | 58 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-27 | 24 | 39 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-27 | 39 | 60 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 65 aa Download sequence Send to blast |
MAPRGRVELR RIEDKASRQV RFSKRRAGLF KKAFELALLC DAEVALLVFS PGGKLYEYSS 60 SRTGM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 7e-18 | 4 | 61 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_B | 7e-18 | 4 | 61 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_C | 7e-18 | 4 | 61 | 2 | 59 | Myocyte-specific enhancer factor 2A |
3mu6_D | 7e-18 | 4 | 61 | 2 | 59 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.4937 | 1e-101 | ear| meristem| pollen| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G171650 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10382970}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G171650_P04 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT068498 | 1e-106 | BT068498.2 Zea mays full-length cDNA clone ZM_BFb0234P15 mRNA, complete cds. | |||
GenBank | EU951938 | 1e-106 | EU951938.1 Zea mays clone 1063645 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001140218.1 | 5e-37 | uncharacterized protein LOC100272251 | ||||
Swissprot | Q9XJ61 | 1e-33 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
TrEMBL | B4FML1 | 1e-35 | B4FML1_MAIZE; MADS transcription factor | ||||
STRING | GRMZM2G171650_P05 | 2e-36 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11880.1 | 8e-27 | AGAMOUS-like 14 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G171650_P04 |
Publications ? help Back to Top | |||
---|---|---|---|
|