PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G170049_P01
Common Namegpm41
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 291aa    MW: 31589 Da    PI: 5.7192
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G170049_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-151562148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEd++l d++ ++G g+W++ +++ g+ R +k+c++rw +yl
  GRMZM2G170049_P01 15 KGLWSPEEDQKLRDYILLHGHGCWSALPAKAGLQRNGKSCRLRWINYL 62
                       678*******************************************97 PP

2Myb_DNA-binding54.33e-1769113248
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        g +++eE+e    +++ lG++ W++Iar+++ gRt++++k++w++yl
  GRMZM2G170049_P01  69 GMFSPEEEETVMSLHATLGNK-WSRIARHLP-GRTDNEVKNYWNSYL 113
                        569******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.211062IPR017930Myb domain
SuperFamilySSF466891.87E-2812109IPR009057Homeodomain-like
SMARTSM007174.2E-111464IPR001005SANT/Myb domain
PfamPF002491.6E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-211669IPR009057Homeodomain-like
CDDcd001671.99E-101862No hitNo description
PROSITE profilePS5129425.02963117IPR017930Myb domain
SMARTSM007173.8E-1467115IPR001005SANT/Myb domain
PfamPF002499.0E-1669113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2670116IPR009057Homeodomain-like
CDDcd001672.55E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGCKACDKPK PNYRKGLWSP EEDQKLRDYI LLHGHGCWSA LPAKAGLQRN GKSCRLRWIN  60
YLRPGLKHGM FSPEEEETVM SLHATLGNKW SRIARHLPGR TDNEVKNYWN SYLKKRVEGK  120
DQGPSTPAPA ASNSDDDSHC VKQRRDDDGT ADSGASEPRE SSSADDSSCL TDPHACRPHA  180
PVPPKVMFAD WLDMDYVGGA LPATAPAAPG LLGAAGVATA STGDRDQHQV MSMSQGSVQV  240
DGPSGADVSL HGFDDSGAGC WEFQEHFDAI DHMQAAGFCD LLSMSDYFGL D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25111183109B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.145240.0endosperm| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G170049
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G170049_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0387440.0BT038744.1 Zea mays full-length cDNA clone ZM_BFb0323B03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140400.10.0uncharacterized LOC100272454
TrEMBLB4FNQ60.0B4FNQ6_MAIZE; MYB transcription factor
STRINGGRMZM2G170049_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.12e-58myb domain protein 18