PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G169884_P01 | ||||||||
Common Name | CA3P3, Zm.162463 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 166aa MW: 18491.4 Da PI: 7.6719 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 144.4 | 2.6e-45 | 35 | 128 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 r+++++lPianv+rimk +lP +akisk+aket+qec +ef++fvt+eas++c+re+rktingdd+++a+ +lG+++y+++++ yl++yre+ GRMZM2G169884_P01 35 RHDNNLLPIANVGRIMKDALPPQAKISKHAKETIQECTTEFVGFVTGEASERCRRERRKTINGDDICHAMRSLGLDHYADAMRRYLQRYRET 126 78899**************************************************************************************9 PP NF-YB 94 eg 95 e+ GRMZM2G169884_P01 127 EE 128 85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.6E-42 | 30 | 129 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.41E-32 | 37 | 133 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.1E-24 | 41 | 104 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.6E-14 | 68 | 86 | No hit | No description |
PRINTS | PR00615 | 3.6E-14 | 87 | 105 | No hit | No description |
PRINTS | PR00615 | 3.6E-14 | 106 | 124 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MSHTSNFTGF SQLEHPQPQR NSRASSSTTH DANVRHDNNL LPIANVGRIM KDALPPQAKI 60 SKHAKETIQE CTTEFVGFVT GEASERCRRE RRKTINGDDI CHAMRSLGLD HYADAMRRYL 120 QRYRETEELA AALNSGGGGH DGNAIQIDVR DELSIFKGSN QQGGRD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 6e-38 | 34 | 125 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 6e-38 | 34 | 125 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G169884 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G169884_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JN974244 | 0.0 | JN974244.1 Zea mays HAP3-like protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001266909.1 | 1e-122 | uncharacterized protein LOC101027253 | ||||
Swissprot | O82248 | 2e-40 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A3L6FE04 | 1e-121 | A0A3L6FE04_MAIZE; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | H9B3R6 | 1e-121 | H9B3R6_MAIZE; CCAAT-HAP3 transcription factor | ||||
STRING | GRMZM2G169884_P01 | 1e-122 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 6e-43 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G169884_P01 |
Entrez Gene | 101027253 |
Publications ? help Back to Top | |||
---|---|---|---|
|