PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G166230_P01 | ||||||||
Common Name | BBR2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 184aa MW: 20263.6 Da PI: 11.0818 | ||||||||
Description | BBR-BPC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 278.6 | 2.9e-85 | 11 | 184 | 126 | 301 |
GAGA_bind 126 lreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtG 217 +r ++++ ++ + a+++ ++k+ +kkr + ++pk+ k +k+kk +++ ++ + +++ +r++ +kk++++v+ng++lD +++P+PvCsCtG GRMZM2G166230_P01 11 TRSNHNIIVTML-AAHPDPDTKPPVKKRWQVRQPKSLKPRKPKK-AAVPPENGALNEHAPRRRGPKKTVGMVINGIELDLANIPTPVCSCTG 100 445555544444.456667777888889****************.667778888888889******************************** PP GAGA_bind 218 alrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301 a++qCY+WG+GGWqSaCCtt+iS+yPLP+stkrrgaRiagrKmSqgafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir GRMZM2G166230_P01 101 APQQCYRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLANPIDLKTFWAKHGTNKFVTIR 184 ***********************************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01226 | 9.4E-97 | 1 | 184 | IPR010409 | GAGA-binding transcriptional activator |
Pfam | PF06217 | 1.1E-88 | 10 | 184 | IPR010409 | GAGA-binding transcriptional activator |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MDITMPHTSS TRSNHNIIVT MLAAHPDPDT KPPVKKRWQV RQPKSLKPRK PKKAAVPPEN 60 GALNEHAPRR RGPKKTVGMV INGIELDLAN IPTPVCSCTG APQQCYRWGA GGWQSACCTT 120 SISTYPLPMS TKRRGARIAG RKMSQGAFKK VLEKLAGEGY NLANPIDLKT FWAKHGTNKF 180 VTIR |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.118429 | 0.0 | embryo| meristem| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G166230 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}. | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G166230_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT064015 | 0.0 | BT064015.1 Zea mays full-length cDNA clone ZM_BFc0131I22 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001152265.1 | 1e-108 | uncharacterized protein LOC100285904 | ||||
Swissprot | P0DH88 | 5e-88 | BBRA_ORYSJ; Barley B recombinant-like protein A | ||||
Swissprot | P0DH89 | 5e-88 | BBRB_ORYSJ; Barley B recombinant-like protein B | ||||
TrEMBL | A0A3L6FZ06 | 1e-134 | A0A3L6FZ06_MAIZE; Barley B recombinant-like protein B | ||||
TrEMBL | B7ZY75 | 1e-134 | B7ZY75_MAIZE; BBR-BPC transcription factor | ||||
STRING | GRMZM2G166230_P02 | 1e-135 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2211 | 36 | 97 | Representative plant | OGRP1865 | 12 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14685.3 | 5e-65 | basic pentacysteine 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G166230_P01 |
Publications ? help Back to Top | |||
---|---|---|---|
|