PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G165972_P04 | ||||||||
Common Name | LOC100280131 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 175aa MW: 19553.3 Da PI: 4.0984 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 73.9 | 3.1e-23 | 44 | 102 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+++++ d++++e+isw + gnsfvv+d++ fa +Lp++Fkh+nf+SFvRQLn+Y GRMZM2G165972_P04 44 FLTKTFDLVADPATDEVISWGRAGNSFVVWDPHVFAAVLLPRFFKHNNFSSFVRQLNTY 102 9*********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 5.6E-26 | 37 | 103 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 1.21E-22 | 40 | 103 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 7.1E-24 | 40 | 145 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.1E-14 | 44 | 67 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 1.6E-20 | 44 | 102 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.1E-14 | 82 | 94 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.1E-14 | 95 | 107 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MDLMLPVTVK EEWPPEEEEE EDVDADADAP RPMEGLHEVG PPPFLTKTFD LVADPATDEV 60 ISWGRAGNSF VVWDPHVFAA VLLPRFFKHN NFSSFVRQLN TYVSAPSTLL AQLLSCDFLF 120 LVGFVLARSG FAVHLASCIV EYSSMSYQST SLSLLLLLTE RTSLYIYISI LCDSQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ldu_A | 6e-18 | 42 | 102 | 18 | 78 | Heat shock factor protein 1 |
5d5u_B | 8e-18 | 42 | 102 | 27 | 87 | Heat shock factor protein 1 |
5d5v_B | 8e-18 | 42 | 102 | 27 | 87 | Heat shock factor protein 1 |
5d5v_D | 8e-18 | 42 | 102 | 27 | 87 | Heat shock factor protein 1 |
5hdg_A | 6e-18 | 42 | 102 | 8 | 68 | Heat shock factor protein 1 |
5hdn_A | 6e-18 | 42 | 102 | 8 | 68 | Heat shock factor protein 1 |
5hdn_B | 6e-18 | 42 | 102 | 8 | 68 | Heat shock factor protein 1 |
5hdn_C | 6e-18 | 42 | 102 | 8 | 68 | Heat shock factor protein 1 |
5hdn_D | 6e-18 | 42 | 102 | 8 | 68 | Heat shock factor protein 1 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G165972 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G165972_P04 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:18064488}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT063038 | 0.0 | BT063038.2 Zea mays full-length cDNA clone ZM_BFc0018M12 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001146536.1 | 8e-71 | uncharacterized LOC100280131 | ||||
Swissprot | Q8H7Y6 | 1e-53 | HFA2D_ORYSJ; Heat stress transcription factor A-2d | ||||
TrEMBL | B8A239 | 2e-69 | B8A239_MAIZE; Heat stress transcription factor A-6b | ||||
TrEMBL | K0D9U3 | 2e-69 | K0D9U3_MAIZE; HSF13 HSF type transcription factor (Fragment) | ||||
STRING | GRMZM2G165972_P02 | 3e-70 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G22830.1 | 2e-36 | heat shock transcription factor A6B |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G165972_P04 |