PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G163761_P01 | ||||||||
Common Name | Zm.10313 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 263aa MW: 28889 Da PI: 5.0114 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 26.7 | 9.3e-09 | 196 | 228 | 22 | 54 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 ++yp+ e+ +LA +gL+ rq+++WF N R + GRMZM2G163761_P01 196 HPYPNDGEKLRLAVTTGLSRRQISNWFINARVR 228 89*****************************98 PP | |||||||
2 | BELL | 56.3 | 8.1e-19 | 52 | 114 | 9 | 71 |
BELL 9 kakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 +akLl ll e++ r ++y +l+ v+ssFe + g g+a+ Yt+l +a+ rhF +L+ ai + GRMZM2G163761_P01 52 QAKLLYLLSELESRRERYFGELERVVSSFEPALGGGAAAAYTTLMARAMGRHFGNLRRAILRR 114 58**********************************************************876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00574 | 5.7E-5 | 1 | 113 | IPR006563 | POX domain |
Pfam | PF07526 | 6.6E-19 | 2 | 111 | IPR006563 | POX domain |
CDD | cd00086 | 1.45E-9 | 172 | 233 | No hit | No description |
SMART | SM00389 | 1.2E-8 | 172 | 236 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 4.8E-25 | 177 | 238 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.51E-17 | 178 | 240 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 2.5E-17 | 189 | 228 | IPR008422 | Homeobox KN domain |
PROSITE profile | PS50071 | 11.402 | 191 | 232 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 263 aa Download sequence Send to blast |
MRPAQELLGE AVRVADLAAA DDEDEDQAAE RLEGGGHRAA RRAAGNDGDG VQAKLLYLLS 60 ELESRRERYF GELERVVSSF EPALGGGAAA AYTTLMARAM GRHFGNLRRA ILRRLRLQAA 120 AAARRSLRRG GEDQDDDDDD DGDGDGEVTE ELVDRLARRT KLAAAARAEQ AWRPLRGLPD 180 GSVAVLRAWL FDHFLHPYPN DGEKLRLAVT TGLSRRQISN WFINARVRLW KPMIEEMYKD 240 EFSDGSAVSS YDDASASGAS SSS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4xrm_A | 2e-16 | 178 | 236 | 5 | 63 | Homeobox protein Meis2 |
4xrm_B | 2e-16 | 178 | 236 | 5 | 63 | Homeobox protein Meis2 |
5bng_A | 2e-16 | 178 | 236 | 1 | 59 | Homeobox protein Meis2 |
5bng_B | 2e-16 | 178 | 236 | 1 | 59 | Homeobox protein Meis2 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.10313 | 0.0 | ear |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G163761 |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G163761_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY082396 | 0.0 | AY082396.1 Zea mays knotted1-interacting protein (kip) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001105184.2 | 0.0 | knotted interacting protein 1 | ||||
Swissprot | Q1PFD1 | 7e-58 | BLH11_ARATH; BEL1-like homeodomain protein 11 | ||||
TrEMBL | A0A1D6KYQ9 | 0.0 | A0A1D6KYQ9_MAIZE; Knotted1-interacting protein | ||||
STRING | GRMZM2G163761_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7715 | 31 | 46 | Representative plant | OGRP133 | 16 | 172 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G75430.1 | 1e-34 | BEL1-like homeodomain 11 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G163761_P01 |