PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G163054_P04 | ||||||||
Common Name | LOC107546771, Zm.120034 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 195aa MW: 21165.5 Da PI: 8.0698 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 96.4 | 2e-30 | 101 | 159 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K vk+s++pr+YYrC+s+gC vkk+ver+++dp++v++tY g Hnh GRMZM2G163054_P04 101 LDDGFKWRKYGKKAVKSSPNPRNYYRCSSEGCGVKKRVERDRDDPRYVITTYDGVHNHA 159 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.5E-32 | 89 | 161 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.31E-27 | 93 | 161 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.996 | 96 | 161 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.0E-34 | 101 | 160 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.0E-24 | 102 | 158 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MAASLGLNPE AVFTSYTSSP PFMSDYVAAS FLPPAVVDST DFSAELDDLH HHLDYSSPAP 60 TLAGARSDRS EKQMIRWCEG GGGEKRLGRI GFRTRSEVEI LDDGFKWRKY GKKAVKSSPN 120 PRNYYRCSSE GCGVKKRVER DRDDPRYVIT TYDGVHNHAS PAAAAIIQYG GGGGFYSPPH 180 SGSPSAASYS GSFVL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 8e-28 | 88 | 162 | 4 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 8e-28 | 88 | 162 | 4 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G163054 |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G163054_P04 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT086427 | 0.0 | BT086427.1 Zea mays full-length cDNA clone ZM_BFc0165H01 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001309782.1 | 1e-143 | uncharacterized protein LOC107546771 | ||||
TrEMBL | C4J6I0 | 1e-141 | C4J6I0_MAIZE; Putative WRKY transcription factor 50 | ||||
STRING | GRMZM2G163054_P04 | 1e-142 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-38 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G163054_P04 |
Entrez Gene | 107546771 |