PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G160687_P03 | ||||||||
Common Name | Zm.134 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 287aa MW: 32163.9 Da PI: 9.3363 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 95.7 | 2.1e-30 | 27 | 76 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ GRMZM2G160687_P03 27 KRIENNTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 76 79***********************************************8 PP | |||||||
2 | K-box | 105.2 | 8.2e-35 | 98 | 193 | 6 | 100 |
K-box 6 gks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 g le++ ++ +qqe+akL+++i++Lq+++Rhl+G+++++LslkeL+qLe++Lek+++kiR++K+ell ++i+++ k+e elq+++++Lr+ GRMZM2G160687_P03 98 GPPlLEHNAQQFYQQESAKLRNQIQMLQNTNRHLVGDSVGNLSLKELKQLESRLEKGISKIRARKSELLAAEISYMAKRETELQNDHMTLRT 189 4456788899********************************************************************************** PP K-box 97 klee 100 k+ee GRMZM2G160687_P03 190 KIEE 193 **97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.585 | 19 | 79 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.3E-41 | 19 | 78 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.09E-32 | 20 | 93 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.04E-44 | 20 | 91 | No hit | No description |
PRINTS | PR00404 | 5.7E-32 | 21 | 41 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 21 | 75 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.8E-26 | 28 | 75 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-32 | 41 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-32 | 56 | 77 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.1E-25 | 103 | 191 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.786 | 107 | 197 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048283 | Biological Process | indeterminate inflorescence morphogenesis | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 287 aa Download sequence Send to blast |
MSFLLKEKEM IIAAGIASMG RGRIEIKRIE NNTSRQVTFC KRRNGLLKKA YELSVLCDAE 60 VALIVFSSRG RLYEYANNSV KATIERYKKA HTVGSSSGPP LLEHNAQQFY QQESAKLRNQ 120 IQMLQNTNRH LVGDSVGNLS LKELKQLESR LEKGISKIRA RKSELLAAEI SYMAKRETEL 180 QNDHMTLRTK IEEGEQQLQQ VTVARSVAAA AAAATNLELN PFLEMDTKCF FTGGPFATLD 240 MKCFLPGSLQ QMLEAQQRQM LATELNLGYQ LAPPGSDAAD NNPHHQF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 9e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 9e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_R | 9e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
1tqe_S | 9e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_A | 9e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_B | 9e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_C | 9e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_D | 9e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_E | 9e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
6c9l_F | 9e-20 | 19 | 87 | 1 | 69 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.134 | 0.0 | ear| endosperm| ovary| pedicel| pericarp |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G160687 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during ovule development. First detected in the ovule primordia and later in the inner and outer integuments, nucellus tissue and the inner layer of the carpel wall. {ECO:0000269|PubMed:10528264}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G160687_P03 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT036695 | 0.0 | BT036695.1 Zea mays full-length cDNA clone ZM_BFb0132D15 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001292923.1 | 0.0 | Zea AGAMOUS homolog2 isoform 1 | ||||
Refseq | XP_008673430.1 | 0.0 | zea AGAMOUS homolog2 isoform X1 | ||||
Refseq | XP_020405641.1 | 0.0 | zea AGAMOUS homolog2 isoform X1 | ||||
Swissprot | Q2QW53 | 1e-120 | MAD13_ORYSJ; MADS-box transcription factor 13 | ||||
TrEMBL | B4FHV7 | 0.0 | B4FHV7_MAIZE; Agamous-like MADS-box protein AGL11 | ||||
STRING | GRMZM2G160687_P03 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP649 | 37 | 144 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G42830.1 | 4e-86 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G160687_P03 |
Entrez Gene | 542325 |