PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G159094_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NAC
Protein Properties Length: 419aa    MW: 46747.6 Da    PI: 8.5187
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G159094_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1691.5e-52151421128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        l pGfrFhPtdeel+++yL++k+++++l++ e i+++diyk++PwdLpk  +++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++v
  GRMZM2G159094_P01  15 LLPGFRFHPTDEELISFYLRRKIQQRPLSV-ELIRQLDIYKYDPWDLPKLSSSGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPV 105
                        579***************************.89***************88888999************************************ PP

                NAM  93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +s+ + + +glkk+Lvfykgra kg ktdW+mheyrl
  GRMZM2G159094_P01 106 YSSeGAKCIGLKKSLVFYKGRAAKGIKTDWMMHEYRL 142
                        **955566***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-5911174IPR003441NAC domain
PROSITE profilePS5100557.7315174IPR003441NAC domain
PfamPF023655.6E-2617142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MDDDRADTNK PDEVLLPGFR FHPTDEELIS FYLRRKIQQR PLSVELIRQL DIYKYDPWDL  60
PKLSSSGEKE WYFYCPRDRK YRNSARPNRV TGAGFWKATG TDRPVYSSEG AKCIGLKKSL  120
VFYKGRAAKG IKTDWMMHEY RLPSLGDPSR PNKTPKDKNI PADDAWAICR VFKKPNSVAQ  180
RVLSRSWGPA SIATADPELL PALQSIQASR FALETSTCSA NRFNSQQQQN LSSSQDGSSC  240
KVITFNRSPY LPSEKDIHSS SVVILPLEIQ SQQKSSDVTS ALLSMAPGIL SSANEAIPNT  300
EFGLLGPSNG YPIDWATDTS GGIVNSDDDP YKRKSGNGYS SGYECGIPRK IKFPFNLGND  360
MMFLMVHGGE VIIDGGTKSS MGGGRRAWNS SQQIWSDIAP YDLDGRLIES RWLEDVNSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-541518017171NO APICAL MERISTEM PROTEIN
1ut4_B4e-541518017171NO APICAL MERISTEM PROTEIN
1ut7_A4e-541518017171NO APICAL MERISTEM PROTEIN
1ut7_B4e-541518017171NO APICAL MERISTEM PROTEIN
4dul_A4e-541518017171NAC domain-containing protein 19
4dul_B4e-541518017171NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G159094
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G159094_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020396513.10.0NAC transcription factor 32
TrEMBLA0A1D6I4840.0A0A1D6I484_MAIZE; NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
STRINGGRMZM2G159094_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.13e-96NAC family protein