PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G158717_P03
Common NameLOC103647922, LOC542193, Zm.19855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family VOZ
Protein Properties Length: 604aa    MW: 66355.2 Da    PI: 6.0999
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G158717_P03genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ393.16.9e-1212674841217
                VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwn 91 
                        p+ps++lgpkcalwdc rpa g+e+  dyc+ +ha laln+ gl+g++pv+rp+gidlkdg+lfaal akvqgk+vgip+c gaat+kspwn
  GRMZM2G158717_P03 267 PSPSQYLGPKCALWDCGRPAGGTEDSGDYCNPYHAGLALNDdGLLGIRPVMRPRGIDLKDGPLFAALIAKVQGKNVGIPVCGGAATSKSPWN 358
                        89**************************************9799************************************************ PP

                VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalaly 183
                        a+elfdlsllege++rewlffd+prrafesgnrkqrslpdy grgwhesrk vmk+f+glkrsyymdpqpsss+ewhl+eyein +dalaly
  GRMZM2G158717_P03 359 APELFDLSLLEGESLREWLFFDTPRRAFESGNRKQRSLPDYGGRGWHESRKLVMKDFAGLKRSYYMDPQPSSSHEWHLFEYEINASDALALY 450
                        ******************************************************************************************** PP

                VOZ 184 rlelklvdekks.akgkvskdsladlqkklgrlta 217
                        rle+k++d kk  ak+k++ ++l+++++++grlta
  GRMZM2G158717_P03 451 RLEYKSSDPKKGaAKSKLA-SPLNEIRQRMGRLTA 484
                        ********99962677775.79***********97 PP

Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MAGDPAAGVG GNAHPASGSK SSRSSTRHRQ FRDRAKVRVD DLQEMFCGLQ SARKESRSAD  60
AAVLEEQVHQ MLREWRAELS VPSPASSLQN SQGNNREASD PPSDTLRLLQ LAVPEEEDDA  120
SSKLLVPPSR QTHEHGQDSR MANTDQQCEA IDGGTAPAQH SLGQGVDGDC GEVSSVANAM  180
FNHRMYYTDY ELNIDDFLCG DGYKINISGS NEDQFNNLHG IGQLGHQQFD LPLDLPPTHS  240
YADANNSEQN TGDVFVHMSD LLTTIWPSPS QYLGPKCALW DCGRPAGGTE DSGDYCNPYH  300
AGLALNDDGL LGIRPVMRPR GIDLKDGPLF AALIAKVQGK NVGIPVCGGA ATSKSPWNAP  360
ELFDLSLLEG ESLREWLFFD TPRRAFESGN RKQRSLPDYG GRGWHESRKL VMKDFAGLKR  420
SYYMDPQPSS SHEWHLFEYE INASDALALY RLEYKSSDPK KGAAKSKLAS PLNEIRQRMG  480
RLTADSPVEN KRTARSKPKA NQNQKDTNAN TRPHVNTPNQ VNAPNAYQTT QQVNQMAFLN  540
GNVVYGPHLP HSESVVYGPH LPHSENVVYG PHLPHSENVV YGPHLPQGYS AEGSSFFWNP  600
SDGT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.198550.0aerial organ| ear| embryo| endosperm| leaf| meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G158717
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G158717_P03
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0396290.0BT039629.1 Zea mays full-length cDNA clone ZM_BFc0035D15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105277.20.0expressed protein DH12
TrEMBLB4FR910.0B4FR91_MAIZE; Transcription factor VOZ1
STRINGGRMZM2G111696_P010.0(Zea mays)
STRINGGRMZM2G158717_P030.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Representative plantOGRP23271335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-133vascular plant one zinc finger protein