PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G158717_P01
Common NameZm.19855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family VOZ
Protein Properties Length: 564aa    MW: 62410.6 Da    PI: 5.925
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G158717_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ218.71.5e-6732144494217
                VOZ  94 elfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrl 185
                        elfdlsllege++rewlffd+prrafesgnrkqrslpdy grgwhesrk vmk+f+glkrsyymdpqpsss+ewhl+eyein +dalalyrl
  GRMZM2G158717_P01 321 ELFDLSLLEGESLREWLFFDTPRRAFESGNRKQRSLPDYGGRGWHESRKLVMKDFAGLKRSYYMDPQPSSSHEWHLFEYEINASDALALYRL 412
                        9******************************************************************************************* PP

                VOZ 186 elklvdekks.akgkvskdsladlqkklgrlta 217
                        e+k++d kk  ak+k++ ++l+++++++grlta
  GRMZM2G158717_P01 413 EYKSSDPKKGaAKSKLA-SPLNEIRQRMGRLTA 444
                        ******99962677775.79***********97 PP

Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009084anatomypericarp
PO:0020040anatomyleaf base
PO:0020127anatomyprimary root
PO:0025142anatomyleaf tip
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007015developmental stageradicle emergence stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MAGDPAAGVG GNAHPASGSK SSRSSTRHRQ FRDRAKVRVD DLQEMFCGLQ SARKESRSAD  60
AAVLEEQVHQ MLREWRAELS VPSPASSLQN SQGNNREASD PPSDTLRLLQ LAVPEEEDDA  120
SSKLLVPPSR QTHEHGQDSR MANTDQQCEA IDGGTAPAQH SLGQGVDGDC GEVSSVANAM  180
FNHRMYYTDY ELNIDDFLCG DGYKINISGS NEDQFNNLHG IGQLGHQQFD LPLDLPPTHS  240
YADANNSEQN TGDVFVHMSD LLTTIWPSPS QYLGPKCALW DCGRPAGGTE DSGDYCNPYH  300
AGLALNDDGL LGIRPVMRPR ELFDLSLLEG ESLREWLFFD TPRRAFESGN RKQRSLPDYG  360
GRGWHESRKL VMKDFAGLKR SYYMDPQPSS SHEWHLFEYE INASDALALY RLEYKSSDPK  420
KGAAKSKLAS PLNEIRQRMG RLTADSPVEN KRTARSKPKA NQNQKDTNAN TRPHVNTPNQ  480
VNAPNAYQTT QQVNQMAFLN GNVVYGPHLP HSESVVYGPH LPHSENVVYG PHLPHSENVV  540
YGPHLPQGYS AEGSSFFWNP SDGT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.198550.0aerial organ| ear| embryo| endosperm| leaf| meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G158717
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G158717_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0396290.0BT039629.1 Zea mays full-length cDNA clone ZM_BFc0035D15 mRNA, complete cds.
GenBankHQ8587650.0HQ858765.1 Zea mays clone UT1681 VOZ transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105277.20.0expressed protein DH12
TrEMBLB4FR910.0B4FR91_MAIZE; Transcription factor VOZ1
STRINGGRMZM2G111696_P010.0(Zea mays)
STRINGGRMZM2G158717_P030.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-103vascular plant one zinc finger protein