PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G152862_P03 | ||||||||
Common Name | ZEAMMB73_932858 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 103aa MW: 11572.4 Da PI: 10.1607 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.3 | 8.7e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtfskRr+g+ KKA E+ vLCdaev v+ifss gkly+y+s GRMZM2G152862_P03 9 KRIENSTNRQVTFSKRRAGLVKKAREIGVLCDAEVGVVIFSSGGKLYDYCS 59 79***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.8E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.043 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.60E-39 | 2 | 65 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-29 | 2 | 65 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.3E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MGRGKIEIKR IENSTNRQVT FSKRRAGLVK KAREIGVLCD AEVGVVIFSS GGKLYDYCSP 60 RTSSVHCPSH SFYSFACLLS SFFFSCVQAK LIAKTQTWLE RQN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 8e-19 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
6byy_B | 8e-19 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
6byy_C | 8e-19 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
6byy_D | 8e-19 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
6bz1_A | 8e-19 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
6bz1_B | 8e-19 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
6bz1_C | 8e-19 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
6bz1_D | 8e-19 | 1 | 65 | 1 | 65 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.336 | 1e-100 | ear| endosperm| ovary| pedicel| pericarp| pollen| shoot| silk |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G152862 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Highly expressed in lodicules, at intermediate levels in stamens, and weakly in carpels. Expressed in pollen. {ECO:0000269|PubMed:10394955, ECO:0000269|PubMed:12905025, ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS16. {ECO:0000269|PubMed:9869408}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G152862_P03 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT040464 | 1e-174 | BT040464.1 Zea mays full-length cDNA clone ZM_BFc0095K06 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004962034.1 | 2e-38 | MADS-box transcription factor 4 | ||||
Refseq | XP_020397915.1 | 1e-38 | MADS29 isoform X1 | ||||
Swissprot | Q40703 | 6e-37 | MADS4_ORYSJ; MADS-box transcription factor 4 | ||||
TrEMBL | B4FTM6 | 2e-70 | B4FTM6_MAIZE; Uncharacterized protein | ||||
STRING | Si023214m | 8e-38 | (Setaria italica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57230.1 | 4e-30 | AGAMOUS-like 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G152862_P03 |