PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G152543_P01
Common NameLOC103643272
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NAC
Protein Properties Length: 392aa    MW: 43377.8 Da    PI: 8.2316
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G152543_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.98.2e-53161431128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        l+pGfrFhPtdeelv++yLk+kv++k++++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t++g+Wkatg+d+++
  GRMZM2G152543_P01  16 LMPGFRFHPTDEELVSFYLKRKVQQKPISI-ELIRQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSVRPNRVTAAGFWKATGTDRPI 106
                        689***************************.89***************9888999************************************* PP

                NAM  93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +s+ +++ vglkk+Lvfykgra +g ktdW+mhe+rl
  GRMZM2G152543_P01 107 YSSeGTKCVGLKKSLVFYKGRAARGMKTDWMMHEFRL 143
                        **956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-5714174IPR003441NAC domain
PROSITE profilePS5100557.08216174IPR003441NAC domain
PfamPF023656.8E-2618143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MEERNGTNME KSDEILMPGF RFHPTDEELV SFYLKRKVQQ KPISIELIRQ LDIYKYDPWD  60
LPKLASTGEK EWYFYCPRDR KYRNSVRPNR VTAAGFWKAT GTDRPIYSSE GTKCVGLKKS  120
LVFYKGRAAR GMKTDWMMHE FRLPSLADPS LPKRPIDKTI PLNDSWTICR IFKKTSSLAQ  180
RALSHTWGPP LLGATEADDM INALQSVQAS EFALESSLQV APAAPAAGQF SSRHGLHVHG  240
QHQQKKGTNS PSLDGSSSCK LINFTSSSPS EEGRPQSLSF PVTFPFEVQG THKTAAAAPV  300
FFGAHPDHHL GGFVVDSSAD VNGGIVGGRS QDSSTRKPSN NGFSTSSGDW ETAGRVSFPF  360
DLGADSSEEW RCNIPWESLL TPAAVQAELL PH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-521617717168NO APICAL MERISTEM PROTEIN
1ut4_B1e-521617717168NO APICAL MERISTEM PROTEIN
1ut7_A1e-521617717168NO APICAL MERISTEM PROTEIN
1ut7_B1e-521617717168NO APICAL MERISTEM PROTEIN
3swm_A1e-521617720171NAC domain-containing protein 19
3swm_B1e-521617720171NAC domain-containing protein 19
3swm_C1e-521617720171NAC domain-containing protein 19
3swm_D1e-521617720171NAC domain-containing protein 19
3swp_A1e-521617720171NAC domain-containing protein 19
3swp_B1e-521617720171NAC domain-containing protein 19
3swp_C1e-521617720171NAC domain-containing protein 19
3swp_D1e-521617720171NAC domain-containing protein 19
4dul_A1e-521617717168NAC domain-containing protein 19
4dul_B1e-521617717168NAC domain-containing protein 19
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G152543
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed at globular stage onward in the COL progenitors after the first division of the hypophyseal cell. Later observed in these cells and their descendants, mostly in direct daughter cells. Also detected in the Epi/LRC stem cells and daughters, and is retained in maturing LRC layers. Present in elongated stem cells that are about to divide. {ECO:0000269|PubMed:19081078}.
UniprotTISSUE SPECIFICITY: Expressed in root cap stem cells and their immediate daughters. {ECO:0000269|PubMed:19081078}.
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G152543_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008664658.10.0transcription factor JUNGBRUNNEN 1
SwissprotQ9ZVH01e-101FEZ_ARATH; Protein FEZ
TrEMBLA0A1D6KNZ40.0A0A1D6KNZ4_MAIZE; NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
STRINGGRMZM2G152543_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-103NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]