PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G149958_P01 | ||||||||
Common Name | pco092156a | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 297aa MW: 30975.3 Da PI: 5.9234 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 33.2 | 1.2e-10 | 17 | 64 | 2 | 45 |
SSS-HHHHHHHHHHHHHTTTT.....-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGgg.....tWktIartmgkgRtlkqcksrwq 45 g+WT e ++ + +av+ +Gg+ +W++ a+ + g+t+++++ ++ GRMZM2G149958_P01 17 GSWTREQEKAFENAVATMGGEedgdaRWEKLAEAVE-GKTPEEVRRHYE 64 79**********************************.**********95 PP | |||||||
2 | Myb_DNA-binding | 39.8 | 1e-12 | 124 | 168 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT++E+ l++ + +++G+g+W++I+r + Rt+ q+ s+ qky GRMZM2G149958_P01 124 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 168 6*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 9.221 | 14 | 71 | IPR017884 | SANT domain |
SMART | SM00717 | 1.7E-7 | 15 | 69 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.4E-5 | 17 | 64 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.3E-8 | 17 | 64 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.03E-10 | 18 | 73 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.34E-8 | 19 | 67 | No hit | No description |
PROSITE profile | PS51294 | 16.605 | 117 | 173 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.94E-16 | 119 | 174 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.3E-11 | 121 | 171 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 2.7E-17 | 121 | 171 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 9.6E-11 | 124 | 167 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.10E-10 | 124 | 169 | No hit | No description |
Pfam | PF00249 | 3.3E-11 | 124 | 168 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 297 aa Download sequence Send to blast |
MAVDEASSSG GGEEGCGSWT REQEKAFENA VATMGGEEDG DARWEKLAEA VEGKTPEEVR 60 RHYELLVEDV DGIESGRVPL PAYAADGAAE EGGGGGKKGS GGGGTHGDKG SAKSAEQERR 120 KGIAWTEDEH RLFLLGLEKY GKGDWRSISR NFVISRTPTQ VASHAQKYFI RLNSMNRERR 180 RSSIHDITSV NNGDPSTAQG PITGQTNGQA ANPGKPSKQS PQPANTPPGV DAYGTTIGQP 240 VGGPLVSAVG TPVTLPVSAP PHLAYGMRAP VPGAVVPGAP VNIAPMPYPM PPPPSHG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 3e-17 | 6 | 87 | 2 | 77 | RADIALIS |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 94 | 102 | GGKKGSGGG |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.23513 | 0.0 | embryo| meristem| ovary| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G149958 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00500 | DAP | Transfer from AT5G08520 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G149958_P01 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT054809 | 0.0 | BT054809.1 Zea mays full-length cDNA clone ZM_BFb0071C23 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001146181.1 | 0.0 | uncharacterized LOC100279751 | ||||
Swissprot | Q9FNN6 | 1e-101 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A3L6G2V4 | 0.0 | A0A3L6G2V4_MAIZE; Transcription factor SRM1 | ||||
TrEMBL | B7ZZR7 | 0.0 | B7ZZR7_MAIZE; Duplicated homeodomain-like superfamily protein | ||||
TrEMBL | K4JBP3 | 0.0 | K4JBP3_MAIZE; MYB-type transcription factor (Fragment) | ||||
STRING | GRMZM2G149958_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6376 | 38 | 54 | Representative plant | OGRP275 | 17 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G08520.1 | 5e-85 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G149958_P01 |
Entrez Gene | 100279751 |
Publications ? help Back to Top | |||
---|---|---|---|
|