PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

GRMZM2G147716_P02

Common Name

pco115876

Organism

Zea mays

Taxonomic ID

4577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea

Family

M-type_MADS

Protein Properties

Length: 111aa MW: 12838.6 Da PI: 9.7215

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
GRMZM2G147716_P02	genome	MaizeSequence	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	102.2	2e-32	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rienk+nrqvtfskRrng+lKKA+E+SvLCdaeva+i+fs++gklyeyss GRMZM2G147716_P02 10 RIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSTKGKLYEYSS 59 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	6.0E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.31	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.06E-42	2	74	No hit	No description
SuperFamily	SSF55455	7.72E-35	2	90	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.0E-32	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.0E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.0E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.0E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010077	Biological Process	maintenance of inflorescence meristem identity
GO:0010154	Biological Process	fruit development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 111 aa Download sequence Send to blast
MGRGPVQLRR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVALIVFST KGKLYEYSSH 60 SSMEGILERY QRYSFEERAV LNPSIEDQAN WGDEYVRLKS KLDALQKSQS C

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-22	1	90	1	89	MEF2C
5f28_B	1e-22	1	90	1	89	MEF2C
5f28_C	1e-22	1	90	1	89	MEF2C
5f28_D	1e-22	1	90	1	89	MEF2C
6byy_A	8e-23	1	85	1	84	MEF2 CHIMERA
6byy_B	8e-23	1	85	1	84	MEF2 CHIMERA
6byy_C	8e-23	1	85	1	84	MEF2 CHIMERA
6byy_D	8e-23	1	85	1	84	MEF2 CHIMERA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Zm.14366	0.0	cell lignification\| ear\| endosperm\| meristem\| ovary\| pollen\| tassel

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	GRMZM2G147716

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Not expressed at early stages of plant development. First detected in leaves 4 weeks after germination, and expression levels are increased when the plant reaches the reproductive stage. {ECO:0000269\|PubMed:15299121}.
Uniprot	TISSUE SPECIFICITY: Widely expressed. Transcripts accumulate to higher levels in organs that retain meristematic characteristics: in the apical meristem and in the meristematic leaf primordia formed on its flank; in the developing panicle at the early stage of rachis-branch primordia differentiation; in the procambium of the rachis branches and in all floral organ primordia. {ECO:0000269\|PubMed:10814814}.
Uniprot	TISSUE SPECIFICITY: Widely expressed. Transcripts accumulate to higher levels in organs that retain meristematic characteristics: in the apical meristem and in the meristematic leaf primordia formed on its flank; in the developing panicle at the early stage of rachis-branch primordia differentiation; in the procambium of the rachis branches and in all floral organ primordia. {ECO:0000269\|PubMed:11971906, ECO:0000269\|PubMed:15299121}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor that may promote floral transition phase and differentiation program of the vegetative shoot. {ECO:0000269\|PubMed:11971906, ECO:0000269\|PubMed:15299121}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	GRMZM2G147716_P02

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT065179	0.0	BT065179.1 Zea mays full-length cDNA clone ZM_BFb0021C02 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001105155.1	2e-75	uncharacterized protein LOC542045
Swissprot	A2YNI2	1e-69	MAD18_ORYSI; MADS-box transcription factor 18
Swissprot	Q0D4T4	1e-69	MAD18_ORYSJ; MADS-box transcription factor 18
TrEMBL	C0PA60	1e-76	C0PA60_MAIZE; Uncharacterized protein
STRING	GRMZM2G147716_P01	8e-75	(Zea mays)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69120.1	5e-51	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	GRMZM2G147716_P02

Publications ? help Back to Top
Jia H, et al. Characterization and transcriptional profiles of two rice MADS-box genes. Plant Sci., 2000. 155(2): p. 115-122 [PMID:10814814] Chen C, et al. Adapting rice anther culture to gene transformation and RNA interference. Sci. China, C, Life Sci., 2006. 49(5): p. 414-28 [PMID:17172048] Yoshida H, et al. superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice. Plant Biotechnol. J., 2007. 5(6): p. 835-46 [PMID:17764519] Yao SG,Ohmori S,Kimizu M,Yoshida H Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development. Plant Cell Physiol., 2008. 49(5): p. 853-7 [PMID:18378529] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Kobayashi K, et al. Inflorescence meristem identity in rice is specified by overlapping functions of three AP1/FUL-like MADS box genes and PAP2, a SEPALLATA MADS box gene. Plant Cell, 2012. 24(5): p. 1848-59 [PMID:22570445] Wei X, et al. Fine mapping of BH1, a gene controlling lemma and palea development in rice. Plant Cell Rep., 2013. 32(9): p. 1455-63 [PMID:23689259] Wang H, et al. OsMADS32 interacts with PI-like proteins and regulates rice flower development. J Integr Plant Biol, 2015. 57(5): p. 504-13 [PMID:25081486] Lombardo F, et al. The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice. Plant Biotechnol. J., 2017. 15(1): p. 97-106 [PMID:27336225]