PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G145444_P01 | ||||||||
Common Name | pco081562, Zm.6005 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 304aa MW: 32165.1 Da PI: 8.7123 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.7 | 6.3e-19 | 11 | 56 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + GRMZM2G145444_P01 11 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 56 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 55.4 | 1.4e-17 | 63 | 106 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+eEd ++ a+++lG++ W++Iar ++ gRt++ +k++w++ GRMZM2G145444_P01 63 RRPFTPEEDAAILAAHARLGNR-WAAIARLLP-GRTDNAVKNHWNS 106 679*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 25.481 | 6 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.68E-31 | 8 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.6E-17 | 10 | 59 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.9E-18 | 11 | 56 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.8E-25 | 12 | 64 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.99E-16 | 13 | 55 | No hit | No description |
SMART | SM00717 | 5.6E-16 | 62 | 110 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 21.861 | 63 | 112 | IPR017930 | Myb domain |
Pfam | PF00249 | 3.6E-15 | 63 | 106 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.05E-12 | 65 | 108 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.5E-24 | 65 | 112 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 304 aa Download sequence Send to blast |
MGVESECDRI KGPWSPEEDE ALRRLVERHG ARNWTAIGRG IPGRSGKSCR LRWCNQLSPQ 60 VERRPFTPEE DAAILAAHAR LGNRWAAIAR LLPGRTDNAV KNHWNSSLKR KLATATATSS 120 GSDAERACKR ASPGPGSPTA SDRSDLSHGC GAAQVFRPVP RAGGFDAISA ADVRPPPPPA 180 VADEDPLTSL SLSLPGLDQS PSGFHHDSAR SHFQELSPSS SPSPQSTPPA FPPQAAPSQS 240 SYAFSGELVA AMQEMIRAEV RKYMSGAGLR AGCGPGAVGE VCMPQLVEGV MRAAAERVGV 300 VTRP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-41 | 8 | 114 | 4 | 110 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.6005 | 0.0 | ear| endosperm| meristem| ovary| pollen| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G145444 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during very late stages of embryogenesis. Later, its expression follows a development dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, inflorescence, and flowers (including stamen, floral nectar, carpel, petal and sepal), mostly in vasculatures and stomata. {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00653 | PBM | Transfer from LOC_Os02g09480 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G145444_P01 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT038391 | 0.0 | BT038391.1 Zea mays full-length cDNA clone ZM_BFb0229K03 mRNA, complete cds. | |||
GenBank | EU956045 | 0.0 | EU956045.1 Zea mays clone 1556153 MYB transcription factor TaMYB1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001147631.1 | 0.0 | uncharacterized protein LOC100281240 | ||||
Swissprot | Q9FDW1 | 4e-70 | MYB44_ARATH; Transcription factor MYB44 | ||||
TrEMBL | A0A3L6ENE5 | 0.0 | A0A3L6ENE5_MAIZE; Transcription factor MYB44 | ||||
TrEMBL | B4FMQ3 | 0.0 | B4FMQ3_MAIZE; MYB transcription factor | ||||
STRING | GRMZM2G145444_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP789 | 38 | 154 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67300.1 | 3e-62 | myb domain protein r1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G145444_P01 |
Entrez Gene | 100281240 |