PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G143328_P01 | ||||||||
Common Name | LOC103651451, MYB53, Zm.13873 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 264aa MW: 29264.3 Da PI: 6.8627 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.2 | 1.6e-17 | 22 | 69 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd++lv ++ q+G g+W+ ar g++R +k+c++rw++yl GRMZM2G143328_P01 22 KGPWTLEEDLILVSYISQHGEGSWDNLARAAGLNRNGKSCRLRWLNYL 69 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 44.9 | 2.7e-14 | 75 | 118 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+ Ed + ++++++G++ W++I+++++ gRt++++k++w++ GRMZM2G143328_P01 75 RGSITAGEDTVIRELHARWGNK-WSKISKHLP-GRTDNEIKNYWRT 118 6788999***************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.369 | 17 | 73 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-20 | 17 | 72 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.35E-30 | 20 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.1E-14 | 21 | 71 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.9E-15 | 22 | 69 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.12E-10 | 24 | 69 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.2E-22 | 73 | 123 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.0E-12 | 74 | 122 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.105 | 74 | 124 | IPR017930 | Myb domain |
Pfam | PF00249 | 8.6E-13 | 75 | 118 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.47E-9 | 79 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 264 aa Download sequence Send to blast |
MTTSRVARSC GRGSDDEPAV RKGPWTLEED LILVSYISQH GEGSWDNLAR AAGLNRNGKS 60 CRLRWLNYLR PGVRRGSITA GEDTVIRELH ARWGNKWSKI SKHLPGRTDN EIKNYWRTRI 120 QQKKQQGAKT TQQREPSTTA SSGAGDDYWC TKPDPDQQAH YCLQKAAMAA ATATTSAVVV 180 SSEDDAPSAA LTSQDSSAAA GGDWYMHQQQ MCYPYCSELS FVAAGHDETV GLDAVTMQFL 240 SSHFTASFWT NGVDDFWESK PIDY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-25 | 18 | 123 | 23 | 127 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G143328 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in floral tissues. expressed in all four whorls of the flower, in the anther vascular tissue and in cells at the junction between anther and stamen filaments. Detected in the nectaries and ovules. {ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:19325888, ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in photomorphogenesis in the light. May act downstream of the light receptor network and directly affects transcription of light-induced genes. In darkness, its probable degradation prevent the activation of light-induced genes. Required to activate expression of PAL. Acts redundantly with MYB24 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB24 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:11967090, ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21447791}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G143328_P01 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by jasmonate. {ECO:0000269|PubMed:16805732}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728193 | 0.0 | KJ728193.1 Zea mays clone pUT6467 MYB transcription factor (MYB53) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008675301.1 | 0.0 | myb-related protein 305 | ||||
Swissprot | Q9LK95 | 2e-59 | MYB21_ARATH; Transcription factor MYB21 | ||||
TrEMBL | A0A060D8J7 | 0.0 | A0A060D8J7_MAIZE; MYB transcription factor (Fragment) | ||||
STRING | GRMZM2G143328_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP13240 | 26 | 33 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27810.1 | 1e-56 | myb domain protein 21 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G143328_P01 |
Entrez Gene | 103651451 |
Publications ? help Back to Top | |||
---|---|---|---|
|