PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G138967_P01 | ||||||||
Common Name | LOC100284189, ZEAMMB73_415160 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 195aa MW: 21239 Da PI: 10.3093 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 63.8 | 1.9e-20 | 29 | 63 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+nC+ttkT+lWR gp+g+k+LCnaCG++yrk+++ GRMZM2G138967_P01 29 CANCHTTKTSLWRGGPEGPKSLCNACGIRYRKRRQ 63 ********************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 2.2E-17 | 23 | 79 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 13.02 | 23 | 59 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 4.5E-16 | 25 | 64 | IPR013088 | Zinc finger, NHR/GATA-type |
SuperFamily | SSF57716 | 9.03E-14 | 26 | 66 | No hit | No description |
CDD | cd00202 | 8.79E-15 | 28 | 68 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 29 | 54 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 3.7E-18 | 29 | 63 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MGMEIDMETY PNLNTSPSAA TASGDAKACA NCHTTKTSLW RGGPEGPKSL CNACGIRYRK 60 RRQAIGLDAG AAAAANSQQD LQQPKKKAAV DPQQQDQHQL RKKTTAVANP QQDRHQPRKR 120 AAAAAAATDP QHTSITKKDT DKKDQQVTVD LHVVGFGKEA TFKQRRRMRH NKCMSEEERA 180 AVLLMALSSG VIYAS |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.26445 | 0.0 | ear| embryo| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G138967 |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00554 | DAP | Transfer from AT5G49300 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G138967_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU967444 | 0.0 | EU967444.1 Zea mays clone 303140 GATA zinc finger family protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001150557.1 | 1e-144 | uncharacterized protein LOC100284189 | ||||
TrEMBL | A0A3L6DMR5 | 1e-143 | A0A3L6DMR5_MAIZE; GATA transcription factor 15 | ||||
TrEMBL | B6TR29 | 1e-143 | B6TR29_MAIZE; GATA zinc finger family protein | ||||
STRING | GRMZM2G138967_P01 | 1e-143 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2418 | 38 | 92 | Representative plant | OGRP68 | 17 | 287 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G06740.1 | 4e-16 | GATA transcription factor 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G138967_P01 |
Entrez Gene | 100284189 |
Publications ? help Back to Top | |||
---|---|---|---|
|