PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G137802_P01 | ||||||||
Common Name | LOC100281947, ZEAMMB73_031547 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 191aa MW: 20098.1 Da PI: 8.9804 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99.1 | 2.8e-31 | 104 | 162 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp +v++tYeg+Hnh GRMZM2G137802_P01 104 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCNVKKRVERDRDDPGYVVTTYEGTHNHA 162 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 8.4E-34 | 90 | 164 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.31E-28 | 96 | 164 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.812 | 99 | 164 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.2E-36 | 104 | 163 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.0E-24 | 105 | 161 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 191 aa Download sequence Send to blast |
MAAVGARPVL YHHHPHPAPA GGAPAPMSSS YFSRGGGSSS PASSLSAAHL DISEFLFDDA 60 SVVVPPDASG GGAISAGGAG SAAAPERPRT DRIAFRTRSE VEVLDDGYKW RKYGKKSVKN 120 SPNPRNYYRC STEGCNVKKR VERDRDDPGY VVTTYEGTHN HASPSTVYYA SQDAASGRFF 180 VAGTQPPGPG L |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-26 | 95 | 165 | 8 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 4e-26 | 95 | 165 | 8 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G137802 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G137802_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU958732 | 0.0 | EU958732.1 Zea mays clone 1711977 WRKY7 - superfamily of TFs having WRKY and zinc finger domains mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008654941.1 | 1e-136 | WRKY7 - superfamily of TFs having WRKY and zinc finger domains isoform X1 | ||||
Swissprot | Q8VWQ5 | 1e-40 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A1D6FWS3 | 1e-134 | A0A1D6FWS3_MAIZE; Putative WRKY DNA-binding domain superfamily protein | ||||
STRING | GRMZM2G137802_P01 | 1e-136 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 1e-41 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G137802_P01 |
Publications ? help Back to Top | |||
---|---|---|---|
|