PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G136887_P01 | ||||||||
Common Name | LOC100274000, ZEAMMB73_836537 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 67aa MW: 7172.29 Da PI: 11.2473 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 37.7 | 4.7e-12 | 5 | 36 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 ++rWT+eE+ l+ +v+++G+g W+tI r GRMZM2G136887_P01 5 KQRWTPEEEAALKAGVAKHGPGKWRTILRDSD 36 79**************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 13.623 | 1 | 51 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.81E-11 | 2 | 50 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.3E-11 | 5 | 50 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.9E-8 | 5 | 33 | IPR001005 | SANT/Myb domain |
CDD | cd11660 | 8.47E-14 | 6 | 50 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006334 | Biological Process | nucleosome assembly | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0000781 | Cellular Component | chromosome, telomeric region | ||||
GO:0000786 | Cellular Component | nucleosome | ||||
GO:0005730 | Cellular Component | nucleolus | ||||
GO:0003691 | Molecular Function | double-stranded telomeric DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043047 | Molecular Function | single-stranded telomeric DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 67 aa Download sequence Send to blast |
MGAPKQRWTP EEEAALKAGV AKHGPGKWRT ILRDSDFSAL LRLRSNVDLK VTLGSPGRVG 60 GGFLAIS |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.79683 | 4e-76 | cell culture| ear| meristem| ovary| root| shoot | ||||
Zm.97693 | 4e-76 | embryo| endosperm| meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G136887 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves. {ECO:0000269|PubMed:14576282}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds preferentially double-stranded telomeric repeats 5'-TTTAGGG-3', but can also bind to the single G-rich and C-rich telomeric strand. {ECO:0000269|PubMed:14576282}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G136887_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY271659 | 1e-78 | AY271659.1 Zea mays single myb histone 1 (Smh1) mRNA, complete cds. | |||
GenBank | BT042177 | 1e-78 | BT042177.1 Zea mays full-length cDNA clone ZM_BFb0153F14 mRNA, complete cds. | |||
GenBank | KJ726904 | 1e-78 | KJ726904.1 Zea mays clone pUT3449 MYB-related transcription factor (MYBR101) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001141858.1 | 5e-28 | single myb histone 1 | ||||
Swissprot | Q6WS85 | 4e-29 | SMH1_MAIZE; Single myb histone 1 | ||||
TrEMBL | A0A3L6R1A1 | 4e-31 | A0A3L6R1A1_PANMI; Single myb histone 1-like | ||||
STRING | GRMZM2G136887_P02 | 2e-27 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G67580.2 | 5e-24 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G136887_P01 |
Publications ? help Back to Top | |||
---|---|---|---|
|