PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G136887_P01
Common NameLOC100274000, ZEAMMB73_836537
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 67aa    MW: 7172.29 Da    PI: 11.2473
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G136887_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.74.7e-12536132
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                       ++rWT+eE+  l+ +v+++G+g W+tI r   
  GRMZM2G136887_P01  5 KQRWTPEEEAALKAGVAKHGPGKWRTILRDSD 36
                       79**************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.623151IPR017930Myb domain
SuperFamilySSF466894.81E-11250IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-11550IPR009057Homeodomain-like
PfamPF002491.9E-8533IPR001005SANT/Myb domain
CDDcd116608.47E-14650No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006334Biological Processnucleosome assembly
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0000781Cellular Componentchromosome, telomeric region
GO:0000786Cellular Componentnucleosome
GO:0005730Cellular Componentnucleolus
GO:0003691Molecular Functiondouble-stranded telomeric DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043047Molecular Functionsingle-stranded telomeric DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020127anatomyprimary root
PO:0007106developmental stageLP.03 three leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
MGAPKQRWTP EEEAALKAGV AKHGPGKWRT ILRDSDFSAL LRLRSNVDLK VTLGSPGRVG  60
GGFLAIS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.796834e-76cell culture| ear| meristem| ovary| root| shoot
Zm.976934e-76embryo| endosperm| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G136887
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves. {ECO:0000269|PubMed:14576282}.
Functional Description ? help Back to Top
Source Description
UniProtBinds preferentially double-stranded telomeric repeats 5'-TTTAGGG-3', but can also bind to the single G-rich and C-rich telomeric strand. {ECO:0000269|PubMed:14576282}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G136887_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2716591e-78AY271659.1 Zea mays single myb histone 1 (Smh1) mRNA, complete cds.
GenBankBT0421771e-78BT042177.1 Zea mays full-length cDNA clone ZM_BFb0153F14 mRNA, complete cds.
GenBankKJ7269041e-78KJ726904.1 Zea mays clone pUT3449 MYB-related transcription factor (MYBR101) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001141858.15e-28single myb histone 1
SwissprotQ6WS854e-29SMH1_MAIZE; Single myb histone 1
TrEMBLA0A3L6R1A14e-31A0A3L6R1A1_PANMI; Single myb histone 1-like
STRINGGRMZM2G136887_P022e-27(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67580.25e-24MYB_related family protein
Publications ? help Back to Top
  1. Soderlund C, et al.
    Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs.
    PLoS Genet., 2009. 5(11): p. e1000740
    [PMID:19936069]
  2. Schnable PS, et al.
    The B73 maize genome: complexity, diversity, and dynamics.
    Science, 2009. 326(5956): p. 1112-5
    [PMID:19965430]