PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G136266_P02 | ||||||||
Common Name | ZEAMMB73_620403, Zm.119007 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 334aa MW: 36006.8 Da PI: 6.5926 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 32.3 | 2.2e-10 | 168 | 226 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 kr++r NR +A rs +RK +++ eLe+kv++L++e ++L +l l+ l++e+ GRMZM2G136266_P02 168 KRAKRILANRQSAARSKERKIMYTSELEKKVQTLQTEATTLSAQLTLLQRDTTGLTAEN 226 9********************************************99998877777665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.3E-16 | 164 | 228 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.852 | 166 | 229 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 3.1E-11 | 168 | 222 | No hit | No description |
Pfam | PF00170 | 3.9E-9 | 168 | 222 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.88E-11 | 168 | 222 | No hit | No description |
CDD | cd14703 | 1.80E-23 | 169 | 218 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 334 aa Download sequence Send to blast |
MDPRFPLPAA AAPSTGGGGG ARGHHRRAHS ETFLSFHDAD LLLDPDGDFF SDLDFPSLSD 60 DSPAASDPTP PPHPQQQPPQ ASPAPRPPGG THTRSLSLDA AFFEGLAFQG PSGSAGGGGG 120 PGHKRSGSMD GDTSPFEGES ALSSGLPDYA KKAMPAERIA ELALIDPKRA KRILANRQSA 180 ARSKERKIMY TSELEKKVQT LQTEATTLSA QLTLLQRDTT GLTAENRELK LRLQSMEEQA 240 KLRDALNEAL REEVQRLKIA AGQVGNMNGN PFNGGLQQQI PSYFVQQQQQ QQTPYFGGHQ 300 AQLHNQNQNH RHQISSNVGQ TLSGQSLNDS MDFM |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 180 | 188 | ARSKERKIM |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.119007 | 0.0 | ear| meristem| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G136266 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in dividing cells, present in leaves, roots and seedlings. {ECO:0000269|PubMed:15108305, ECO:0000269|PubMed:15824315}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions. {ECO:0000269|PubMed:11432846, ECO:0000269|PubMed:12124400, ECO:0000269|PubMed:15108305, ECO:0000269|PubMed:15824315, ECO:0000269|PubMed:17947581, ECO:0000269|PubMed:19820165, ECO:0000269|PubMed:20547563}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G136266_P02 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptionally activated during the acquisition of pluripotentiality (in protoplasts) by pericentromeric chromatin decondensation and DNA demethylation. Targeted to degradation by the proteasome by VBF and Agrobacterium virF in SCF(VBF) and SCF(virF) E3 ubiquitin ligase complexes after mediating T-DNA translocation to the nucleus. {ECO:0000269|PubMed:15108305}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT039404 | 0.0 | BT039404.1 Zea mays full-length cDNA clone ZM_BFc0012D19 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001151647.1 | 0.0 | transcription factor PosF21 | ||||
Swissprot | Q9MA75 | 1e-70 | VIP1_ARATH; Transcription factor VIP1 | ||||
TrEMBL | B4FQL6 | 0.0 | B4FQL6_MAIZE; Transcription factor VIP1 | ||||
TrEMBL | K7TX82 | 0.0 | K7TX82_MAIZE; Transcription factor VIP1 | ||||
STRING | GRMZM2G136266_P01 | 0.0 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G43700.1 | 1e-44 | VIRE2-interacting protein 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G136266_P02 |