PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G131516_P01 | ||||||||
Common Name | SCR | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 140aa MW: 15229.2 Da PI: 5.6514 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 141.3 | 1e-43 | 1 | 132 | 241 | 374 |
GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek 332 +veq+++h s+sFl+rf+ea++yysalfdsl+a+++++s er++vE++ll+rei+nv+a g +r+ + + +++Wre+l ++GF++++l + GRMZM2G131516_P01 1 MVEQDLSH-SGSFLARFVEAIHYYSALFDSLDASYGEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVK-FGSWREKLAQSGFRAASLAGS 90 699****9.899****************************************************999987.********************* PP GRAS 333 aakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 aa+qa+lll +++sdgy++ ee+g+l lgWkd L+++SaWr GRMZM2G131516_P01 91 AAAQASLLLGMFPSDGYTLVEENGALKLGWKDLCLLTASAWR 132 *****************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 20.268 | 1 | 112 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 3.5E-41 | 1 | 132 | IPR005202 | Transcription factor GRAS |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0008356 | Biological Process | asymmetric cell division | ||||
GO:0009630 | Biological Process | gravitropism | ||||
GO:0009956 | Biological Process | radial pattern formation | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0051457 | Biological Process | maintenance of protein location in nucleus | ||||
GO:0090610 | Biological Process | bundle sheath cell fate specification | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MVEQDLSHSG SFLARFVEAI HYYSALFDSL DASYGEDSPE RHVVEQQLLS REIRNVLAVG 60 GPARTGDVKF GSWREKLAQS GFRAASLAGS AAAQASLLLG MFPSDGYTLV EENGALKLGW 120 KDLCLLTASA WRPIQVPPCR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3h_A | 7e-74 | 1 | 133 | 247 | 379 | Protein SCARECROW |
5b3h_D | 7e-74 | 1 | 133 | 247 | 379 | Protein SCARECROW |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.14757 | 0.0 | ear| meristem| ovary| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G131516 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in early stages of lateral root primordium formation, becoming restricted to the endodermal cell lineage at later stages. {ECO:0000269|PubMed:10948251}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the root endodermis and in a single file of cells through the quiescent center. {ECO:0000269|PubMed:10948251}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in establishing and maintaining the correct radial pattern in the root apical meristem. {ECO:0000269|PubMed:10948251}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G131516_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF263457 | 0.0 | AF263457.1 Zea mays SCARECROW (SCR) gene, complete cds. | |||
GenBank | BT063682 | 0.0 | BT063682.1 Zea mays full-length cDNA clone ZM_BFc0094J16 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001168484.1 | 2e-94 | protein SCARECROW | ||||
Refseq | XP_021317511.1 | 5e-94 | protein SCARECROW | ||||
Swissprot | Q9FUZ7 | 2e-95 | SCR_MAIZE; Protein SCARECROW | ||||
TrEMBL | A0A1Q0YY06 | 6e-93 | A0A1Q0YY06_MAIZE; Scarecrow1 | ||||
TrEMBL | A0A1Z5RG85 | 1e-92 | A0A1Z5RG85_SORBI; Uncharacterized protein | ||||
TrEMBL | A0A3L6F9E1 | 5e-93 | A0A3L6F9E1_MAIZE; Protein SCARECROW | ||||
TrEMBL | C0P5W3 | 3e-95 | C0P5W3_MAIZE; Uncharacterized protein | ||||
STRING | Sb05g001500.1 | 5e-94 | (Sorghum bicolor) | ||||
STRING | GRMZM2G131516_P02 | 9e-94 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54220.1 | 5e-63 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G131516_P01 |
Entrez Gene | 100382261 |
Publications ? help Back to Top | |||
---|---|---|---|
|