PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G131442_P01 | ||||||||
Common Name | ZEAMMB73_447404 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 347aa MW: 37887.9 Da PI: 6.7324 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.4 | 2.9e-17 | 55 | 102 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT +Ed+ l+++++ +G g+W++ ar g++Rt+k+c++rw++yl GRMZM2G131442_P01 55 RGPWTVDEDLTLINYIADHGEGRWNALARAAGLKRTGKSCRLRWLNYL 102 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 53.1 | 7.6e-17 | 108 | 151 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg +T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++ GRMZM2G131442_P01 108 RGDFTADEQLLILDLHSRWGNR-WSKIAAHLP-GRTDNEIKNYWRT 151 899*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.269 | 50 | 102 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.62E-30 | 53 | 149 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.3E-15 | 54 | 104 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.6E-16 | 55 | 102 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-22 | 56 | 109 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.08E-11 | 57 | 102 | No hit | No description |
PROSITE profile | PS51294 | 23.521 | 103 | 157 | IPR017930 | Myb domain |
SMART | SM00717 | 3.0E-15 | 107 | 155 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-15 | 108 | 151 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.1E-24 | 110 | 156 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.20E-11 | 111 | 151 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0025541 | anatomy | bundle sheath cell | ||||
PO:0025589 | anatomy | leaf lamina tip | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 347 aa Download sequence Send to blast |
MVSAATAGGG MRPAGAATTV KKARQELELE QERELRFPQA AAAADQGGLD EELRRGPWTV 60 DEDLTLINYI ADHGEGRWNA LARAAGLKRT GKSCRLRWLN YLRPDVKRGD FTADEQLLIL 120 DLHSRWGNRW SKIAAHLPGR TDNEIKNYWR TRVQKHAKQL NCDVNSKRFK DAMRFLWMPR 180 LAERAATAAH QPQPQHVAAA CNNVLVAAAA AANSSSCCWS SPRSSAVTTA ACSGSSSCSS 240 LTSESAHNDD DGARPHAAAV LAAAAAATGD DDYWGAVTTT MQQNHHQQQQ QNEQFDFWST 300 ASALQHLTTA AADQDLTGWV QGFSDDGILS GSSSDSLWSL DDIWRMQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-26 | 46 | 155 | 18 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.103437 | 1e-140 | ovary |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G131442 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269|PubMed:11310740}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G131442_P01 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269|PubMed:11310740}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728414 | 0.0 | KJ728414.1 Zea mays clone pUT6719 MYB transcription factor (MYB4) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001337742.1 | 0.0 | uncharacterized protein LOC109939245 | ||||
Swissprot | Q2QZJ8 | 1e-102 | JAMYB_ORYSJ; Transcription factor JAMYB | ||||
TrEMBL | A0A3L6EWM6 | 0.0 | A0A3L6EWM6_MAIZE; Transcription factor MYB78 | ||||
TrEMBL | K7TU66 | 0.0 | K7TU66_MAIZE; MYB transcription factor | ||||
STRING | GRMZM2G131442_P02 | 0.0 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G48000.1 | 2e-77 | myb domain protein 112 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G131442_P01 |
Publications ? help Back to Top | |||
---|---|---|---|
|