PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G128953_P02 | ||||||||
Common Name | ZEAMMB73_271825 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 146aa MW: 17190.9 Da PI: 9.8797 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 83.1 | 1.7e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien +nrqvtfskRr g++KKA+E+ +LCda++ viifs +g++yeyss GRMZM2G128953_P02 9 KKIENPTNRQVTFSKRRMGLFKKANEVAILCDAQIGVIIFSGSGRMYEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 43.1 | 1.8e-15 | 85 | 144 | 14 | 73 |
K-box 14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnell 73 +++ qe++++k+e + L+ +++ edL s s+++L +Leqq+e sl k+R +K+ell GRMZM2G128953_P02 85 QQKIVQEMTRMKDERNRLRMIMAQYMAEDLASFSVQDLSNLEQQIEFSLYKVRLRKQELL 144 68999*****************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.941 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.2E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.57E-28 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.72E-35 | 2 | 76 | No hit | No description |
PRINTS | PR00404 | 1.0E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.7E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.0E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 8.4E-13 | 81 | 144 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 10.642 | 85 | 146 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MGHGKVELKK IENPTNRQVT FSKRRMGLFK KANEVAILCD AQIGVIIFSG SGRMYEYSSP 60 PWRIASVFDR YLKAPSTRFE EMDIQQKIVQ EMTRMKDERN RLRMIMAQYM AEDLASFSVQ 120 DLSNLEQQIE FSLYKVRLRK QELLDQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 6e-16 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 6e-16 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_R | 6e-16 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_S | 6e-16 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_A | 6e-16 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_B | 6e-16 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_C | 6e-16 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_D | 6e-16 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_E | 6e-16 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_F | 6e-16 | 1 | 60 | 1 | 60 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.12001 | 0.0 | meristem| pericarp| root| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G128953 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G128953_P02 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU975425 | 0.0 | EU975425.1 Zea mays clone 490157 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020400356.1 | 1e-105 | MADS-box transcription factor 31 | ||||
Swissprot | Q84NC2 | 2e-89 | MAD31_ORYSJ; MADS-box transcription factor 31 | ||||
TrEMBL | A0A1D6HRZ7 | 1e-100 | A0A1D6HRZ7_MAIZE; Protein TRANSPARENT TESTA 16 | ||||
STRING | AC233912.1_FGP001 | 1e-103 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 1e-40 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G128953_P02 |
Publications ? help Back to Top | |||
---|---|---|---|
|