PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G125969_P02 | ||||||||
Common Name | cl30385_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 153aa MW: 16434.6 Da PI: 4.4944 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 79.3 | 6.2e-25 | 52 | 110 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d++++ ++sws+++nsfvv+d++ fa+ +Lp++Fkh+nf+SFvRQLn+Y GRMZM2G125969_P02 52 FLTKTYDMVDDSDTDLIVSWSATNNSFVVWDPHAFATVLLPRHFKHNNFSSFVRQLNTY 110 9********************999**********************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 8.0E-27 | 46 | 111 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 2.04E-23 | 48 | 111 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 4.9E-28 | 48 | 136 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.7E-14 | 52 | 75 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 6.0E-21 | 52 | 110 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.7E-14 | 90 | 102 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.7E-14 | 103 | 115 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MDSTLNQVKE ESHGEGGDLM AGTVEAADGP SAAVAAAPKP MEGLHDPGPP PFLTKTYDMV 60 DDSDTDLIVS WSATNNSFVV WDPHAFATVL LPRHFKHNNF SSFVRQLNTY VSVCLPITVQ 120 HGMVHDAEVL TGLNVQLPNT TLLTILQVVG AIL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 2e-18 | 16 | 110 | 4 | 87 | Heat shock factor protein 1 |
5d5v_B | 2e-18 | 16 | 110 | 4 | 87 | Heat shock factor protein 1 |
5d5v_D | 2e-18 | 16 | 110 | 4 | 87 | Heat shock factor protein 1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.15325 | 0.0 | ear| embryo| meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G125969 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00371 | DAP | Transfer from AT3G22830 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G125969_P02 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:18064488}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT056006 | 0.0 | BT056006.1 Zea mays full-length cDNA clone ZM_BFc0120E04 mRNA, complete cds. | |||
GenBank | EU956700 | 0.0 | EU956700.1 Zea mays clone 1571069 heat shock factor protein HSF30 mRNA, complete cds. | |||
GenBank | JX469968 | 0.0 | JX469968.1 Zea mays subsp. mays clone UT3231 HSF-type transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001146716.1 | 2e-75 | uncharacterized LOC100280318 | ||||
Swissprot | Q6VBB2 | 6e-46 | HFA2B_ORYSJ; Heat stress transcription factor A-2b | ||||
TrEMBL | B6SVD5 | 4e-74 | B6SVD5_MAIZE; Heat shock factor protein HSF30 | ||||
TrEMBL | K4JEA8 | 4e-74 | K4JEA8_MAIZE; HSF-type transcription factor (Fragment) | ||||
STRING | GRMZM2G125969_P01 | 7e-75 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G22830.1 | 9e-37 | heat shock transcription factor A6B |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G125969_P02 |
Publications ? help Back to Top | |||
---|---|---|---|
|