PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G125522_P01 | ||||||||
Common Name | LOC100192816, MYB34 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 272aa MW: 30543.5 Da PI: 8.4708 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 29.7 | 1.5e-09 | 32 | 79 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47 ++WT+ E +l+ +a +q + +W+++a+ + ++t +++++++++ GRMZM2G125522_P01 32 DAWTAAENKLFEKALAQIDRNapdRWEKVAEVVR-TKTVDDVRNHYHDL 79 58*****************99*************.***********976 PP | |||||||
2 | Myb_DNA-binding | 47.7 | 3.6e-15 | 135 | 179 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE++l++ + k++G g+W+ I+r+ ++Rt+ q+ s+ qky GRMZM2G125522_P01 135 PWTEEEHKLFLMGLKKYGRGDWRNISRKYVTTRTPTQVASHAQKY 179 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 9.53 | 29 | 82 | IPR017884 | SANT domain |
SMART | SM00717 | 6.3E-8 | 30 | 82 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.68E-11 | 32 | 86 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.1E-4 | 33 | 78 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.68E-7 | 33 | 79 | No hit | No description |
Pfam | PF00249 | 1.2E-7 | 33 | 79 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.025 | 127 | 184 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.31E-17 | 130 | 184 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 4.6E-17 | 131 | 182 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 9.0E-12 | 132 | 178 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.0E-13 | 132 | 182 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.55E-11 | 135 | 180 | No hit | No description |
Pfam | PF00249 | 1.3E-12 | 135 | 179 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 272 aa Download sequence Send to blast |
MMAEAWTPVP FPPTAPCFWL HDTHSVFWRG GDAWTAAENK LFEKALAQID RNAPDRWEKV 60 AEVVRTKTVD DVRNHYHDLE NDVGFIEAGL VPFPHYSGSV PSFGFTHEDW DGGFRRGYCL 120 KRARGSDPER KKGVPWTEEE HKLFLMGLKK YGRGDWRNIS RKYVTTRTPT QVASHAQKYF 180 IRLNSGGKDK RRSSIHDITT VNLPDEDRGN APPSAVTTTT NPSVALVDMK PFVAPSLGVP 240 HPYGDVKLEP KSSLVAGLGF NDSVLLMHCG QL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 3e-16 | 31 | 96 | 8 | 73 | RADIALIS |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.8214 | 0.0 | ear| ovary |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G125522 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G125522_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT034900 | 0.0 | BT034900.1 Zea mays full-length cDNA clone ZM_BFb0026O20 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001131480.1 | 0.0 | uncharacterized protein LOC100192816 | ||||
Swissprot | Q8S9H7 | 5e-72 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | B4FCR2 | 0.0 | B4FCR2_MAIZE; Duplicated homeodomain-like superfamily protein | ||||
STRING | GRMZM2G125522_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2274 | 37 | 96 | Representative plant | OGRP275 | 17 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G58900.1 | 3e-75 | Homeodomain-like transcriptional regulator |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G125522_P01 |
Entrez Gene | 100192816 |
Publications ? help Back to Top | |||
---|---|---|---|
|