PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G124566_P02 | ||||||||
Common Name | GRF9, LOC100286247, ZEAMMB73_057957 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 221aa MW: 23320.7 Da PI: 10.3945 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 81 | 1e-25 | 135 | 179 | 1 | 45 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 ++epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++e+ GRMZM2G124566_P02 135 EPEPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPVEA 179 69****************************************985 PP | |||||||
2 | QLQ | 53.3 | 8.2e-19 | 69 | 105 | 1 | 37 |
QLQ 1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 sa+T +Q q+L++Q+l+y+y+aa++PvP +L+++i+k GRMZM2G124566_P02 69 SALTFMQQQELEHQVLIYRYFAAGAPVPVHLVLPIWK 105 799*********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00951 | 6.5E-6 | 69 | 105 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 5.1E-11 | 70 | 104 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51666 | 21.225 | 70 | 105 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 25.701 | 135 | 179 | IPR014977 | WRC domain |
Pfam | PF08879 | 3.1E-21 | 136 | 178 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006995 | Biological Process | cellular response to nitrogen starvation | ||||
GO:0008285 | Biological Process | negative regulation of cell proliferation | ||||
GO:0009624 | Biological Process | response to nematode | ||||
GO:0009631 | Biological Process | cold acclimation | ||||
GO:0016036 | Biological Process | cellular response to phosphate starvation | ||||
GO:0048364 | Biological Process | root development | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0050826 | Biological Process | response to freezing | ||||
GO:0051365 | Biological Process | cellular response to potassium ion starvation | ||||
GO:0061062 | Biological Process | regulation of nematode larval development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0005524 | Molecular Function | ATP binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 221 aa Download sequence Send to blast |
MAEDKETDSP QPPAKLPRLS RADTSAGEVT MAASSPLVLG LGLGLGGRGG GGERDADVSP 60 ATVTPKRPSA LTFMQQQELE HQVLIYRYFA AGAPVPVHLV LPIWKSVAAS SFGPQRFPSL 120 MGLGSLCFDY RSSMEPEPGR CRRTDGKKWR CSRDVVPGHK YCERHVHRGR GRSRKPVEAA 180 AAPAAAAGGS SPVLRVAAPQ HVLGLSSPTS VLLAHGAARA T |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 45 | 51 | GGRGGGG |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.35364 | 0.0 | ear| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G124566 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G124566_P02 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ727857 | 0.0 | KJ727857.1 Zea mays clone pUT5948 GRF transcription factor (GRF9) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001334126.1 | 1e-158 | uncharacterized protein LOC100286247 | ||||
Swissprot | Q6EPP9 | 1e-98 | GRF10_ORYSJ; Growth-regulating factor 10 | ||||
TrEMBL | K7TZB5 | 1e-157 | K7TZB5_MAIZE; GRF transcription factor | ||||
STRING | GRMZM2G124566_P01 | 1e-131 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G36400.1 | 4e-38 | growth-regulating factor 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G124566_P02 |
Entrez Gene | 100286247 |
Publications ? help Back to Top | |||
---|---|---|---|
|