PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G124566_P01 | ||||||||
Common Name | LOC100286247, ZEAMMB73_057957 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 229aa MW: 24184.6 Da PI: 10.7682 | ||||||||
Description | GRF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 81 | 1.1e-25 | 143 | 187 | 1 | 45 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 ++epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++e+ GRMZM2G124566_P01 143 EPEPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPVEA 187 69****************************************985 PP | |||||||
2 | QLQ | 53.3 | 8.6e-19 | 77 | 113 | 1 | 37 |
QLQ 1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 sa+T +Q q+L++Q+l+y+y+aa++PvP +L+++i+k GRMZM2G124566_P01 77 SALTFMQQQELEHQVLIYRYFAAGAPVPVHLVLPIWK 113 799*********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00951 | 6.5E-6 | 77 | 113 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 5.4E-11 | 78 | 112 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51666 | 21.225 | 78 | 113 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 25.701 | 143 | 187 | IPR014977 | WRC domain |
Pfam | PF08879 | 3.3E-21 | 144 | 186 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006995 | Biological Process | cellular response to nitrogen starvation | ||||
GO:0008285 | Biological Process | negative regulation of cell proliferation | ||||
GO:0009624 | Biological Process | response to nematode | ||||
GO:0009631 | Biological Process | cold acclimation | ||||
GO:0016036 | Biological Process | cellular response to phosphate starvation | ||||
GO:0048364 | Biological Process | root development | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0050826 | Biological Process | response to freezing | ||||
GO:0051365 | Biological Process | cellular response to potassium ion starvation | ||||
GO:0061062 | Biological Process | regulation of nematode larval development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0005524 | Molecular Function | ATP binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 229 aa Download sequence Send to blast |
MAEDKETDSP QPPAKLPRLS RADTSAGKHA RAGSREVTMA ASSPLVLGLG LGLGGRGGGG 60 ERDADVSPAT VTPKRPSALT FMQQQELEHQ VLIYRYFAAG APVPVHLVLP IWKSVAASSF 120 GPQRFPSLMG LGSLCFDYRS SMEPEPGRCR RTDGKKWRCS RDVVPGHKYC ERHVHRGRGR 180 SRKPVEAAAA PAAAAGGSSP VLRVAAPQHV LGLSSPTSVL LAHGAARAT |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 53 | 59 | GGRGGGG |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.35364 | 0.0 | ear| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G124566 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G124566_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU976393 | 0.0 | EU976393.1 Zea mays clone 881905 growth-regulating factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001334126.1 | 1e-132 | uncharacterized protein LOC100286247 | ||||
Swissprot | Q6EPP9 | 1e-95 | GRF10_ORYSJ; Growth-regulating factor 10 | ||||
TrEMBL | B6UGM8 | 1e-163 | B6UGM8_MAIZE; Growth-regulating factor | ||||
STRING | GRMZM2G124566_P01 | 1e-164 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6221 | 30 | 51 | Representative plant | OGRP460 | 16 | 84 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G36400.1 | 5e-38 | growth-regulating factor 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G124566_P01 |
Entrez Gene | 100286247 |
Publications ? help Back to Top | |||
---|---|---|---|
|