PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G118690_P01 | ||||||||
Common Name | LOC100273963, ZEAMMB73_900976 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 330aa MW: 36491.2 Da PI: 10.1832 | ||||||||
Description | BBR-BPC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 383.1 | 4.5e-117 | 1 | 330 | 1 | 301 |
GAGA_bind 1 mdddgsre..rnkg.yye........paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkl 81 md+ g+re r+++ +y+ p+++lk++++++l+++++e+d++irer++al+ekkaa+aerdmaf+qrd+a+aern+a+verdn+l GRMZM2G118690_P01 1 MDNLGHREngRQRPeQYKalhtqwmiPQRQLKDHQSMNLLALMNEKDSAIRERDHALAEKKAAIAERDMAFAQRDAAMAERNAAIVERDNAL 92 9999*99999****99*9******99889*************************************************************** PP GAGA_bind 82 lalllvensla...salpvgvq.vlsgtksidslqqlse.....pqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekk 163 +al+l++++ s +++ ++ l+gtk+i+++++ls+ ql++s+++ +re++++ea+pi +a+ ++ ++kk++k++++++p ++ GRMZM2G118690_P01 93 AALELARTNGFnmnSGNGFHQGpPLNGTKNIHHHDHLSHvqtspLQLANSPYDhVREMHISEAYPIATAPASVGKAKKPRKSNSQASPSKRP 184 ***998887654444444444324889999999999888888999********9***************************99999999999 PP GAGA_bind 164 ak..kkkkksekskkkvkkesad.er.....skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvs 247 + +k+kk ++++k+ + + ++ +k+e+k++dl+ln+v +Dest+P+P+CsCtG l+qCYkWG+GGWqS+CCt+++S++PLPv+ GRMZM2G118690_P01 185 SGvlRKTKKATSDWKNAGTTGGAgDSarasvMKNEWKDQDLGLNQVVFDESTMPAPACSCTGELHQCYKWGSGGWQSSCCTMNMSMHPLPVM 276 98674444455555555554433233678889************************************************************ PP GAGA_bind 248 tkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301 ++rr+aR++grKmS+gaf klL++LaaeG+dls+pvDLkdhWAkHGtn+++tir GRMZM2G118690_P01 277 PNRRHARMGGRKMSGGAFAKLLSRLAAEGHDLSTPVDLKDHWAKHGTNRYITIR 330 *****************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF06217 | 2.0E-95 | 1 | 330 | IPR010409 | GAGA-binding transcriptional activator |
SMART | SM01226 | 4.8E-161 | 1 | 330 | IPR010409 | GAGA-binding transcriptional activator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0005730 | Cellular Component | nucleolus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 330 aa Download sequence Send to blast |
MDNLGHRENG RQRPEQYKAL HTQWMIPQRQ LKDHQSMNLL ALMNEKDSAI RERDHALAEK 60 KAAIAERDMA FAQRDAAMAE RNAAIVERDN ALAALELART NGFNMNSGNG FHQGPPLNGT 120 KNIHHHDHLS HVQTSPLQLA NSPYDHVREM HISEAYPIAT APASVGKAKK PRKSNSQASP 180 SKRPSGVLRK TKKATSDWKN AGTTGGAGDS ARASVMKNEW KDQDLGLNQV VFDESTMPAP 240 ACSCTGELHQ CYKWGSGGWQ SSCCTMNMSM HPLPVMPNRR HARMGGRKMS GGAFAKLLSR 300 LAAEGHDLST PVDLKDHWAK HGTNRYITIR |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.35091 | 0.0 | meristem| ovary| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G118690 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00540 | DAP | Transfer from AT5G42520 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G118690_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT042108 | 0.0 | BT042108.1 Zea mays full-length cDNA clone ZM_BFb0133I03 mRNA, complete cds. | |||
GenBank | BT084404 | 0.0 | BT084404.1 Zea mays full-length cDNA clone ZM_BFb0109H20 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001141822.1 | 0.0 | BBR/BPC transcription factor | ||||
Refseq | XP_008658294.1 | 0.0 | BBR/BPC transcription factor isoform X1 | ||||
Swissprot | Q5VSA8 | 0.0 | BBRD_ORYSJ; Barley B recombinant-like protein D | ||||
TrEMBL | B4FYC0 | 0.0 | B4FYC0_MAIZE; BBR/BPC transcription factor | ||||
STRING | GRMZM2G118690_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6226 | 37 | 56 | Representative plant | OGRP2841 | 13 | 31 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G42520.1 | 1e-100 | basic pentacysteine 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G118690_P01 |
Entrez Gene | 100273963 |
Publications ? help Back to Top | |||
---|---|---|---|
|