PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G116646_P04 | ||||||||
Common Name | gpm293 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 185aa MW: 20855.5 Da PI: 9.2599 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 175.4 | 3.5e-54 | 1 | 148 | 31 | 170 |
YABBY 31 lfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee...lleelkveeenlksnvekee.sastsvssekl..senedeevpr..vpp 114 ++++vtvrCGhC++llsvnl+ ++ l+ ++h ++ + + + +l+++++ + ++ + s+s+ ++ + ++ne++ +++ + GRMZM2G116646_P04 1 MLNIVTVRCGHCANLLSVNLRALMHSLPEQDHQLQQENIKvhgINGTLHDDHQYCGHLDQLGSsSSSRFRRLPVMcsPQNEQHLLQEqtLNN 92 579***************************98433332224575666666666665554443303333344444454444444333211344 PP YABBY 115 virPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 rPPekrqrvPsaynrfikeei+rika+nPdi hreafs+aaknWah+P+ihfgl GRMZM2G116646_P04 93 NARPPEKRQRVPSAYNRFIKEEIRRIKANNPDINHREAFSTAAKNWAHYPNIHFGL 148 78****************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 6.9E-54 | 1 | 148 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 3.93E-8 | 93 | 142 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 9.6E-5 | 95 | 142 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MLNIVTVRCG HCANLLSVNL RALMHSLPEQ DHQLQQENIK VHGINGTLHD DHQYCGHLDQ 60 LGSSSSSRFR RLPVMCSPQN EQHLLQEQTL NNNARPPEKR QRVPSAYNRF IKEEIRRIKA 120 NNPDINHREA FSTAAKNWAH YPNIHFGLDD SGREGKKKLV DHEAAASVVA VAAAPTAAKK 180 IQGFY |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.2442 | 0.0 | aerial organ| embryo| endosperm| meristem| ovary| pedicel| pericarp |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G116646 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaf blades, leaf sheaths and flowers. {ECO:0000269|PubMed:17216490}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G116646_P04 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT068409 | 0.0 | BT068409.1 Zea mays full-length cDNA clone ZM_BFb0157I12 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001353892.1 | 1e-119 | uncharacterized protein LOC100193531 | ||||
Swissprot | Q2QM17 | 2e-59 | YAB6_ORYSJ; Protein YABBY 6 | ||||
TrEMBL | A0A1D6MVD3 | 1e-117 | A0A1D6MVD3_MAIZE; Putative axial regulator YABBY 2 | ||||
TrEMBL | C0PJE0 | 1e-117 | C0PJE0_MAIZE; Putative axial regulator YABBY 2 | ||||
STRING | GRMZM2G116646_P02 | 1e-118 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 8e-43 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G116646_P04 |