PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G111696_P03
Common NameLOC103647922, LOC542193, Zm.19855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family VOZ
Protein Properties Length: 420aa    MW: 46618.8 Da    PI: 6.4054
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G111696_P03genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ394.32.9e-121833001217
                VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwn 91 
                        p+ps++lgpkcalwdc rpa g+e+  dyc+ +ha laln+ gl+g++pv+rp+gidlkdg+lfaal akvqgk+vgip+c gaat+kspwn
  GRMZM2G111696_P03  83 PSPSQYLGPKCALWDCGRPAGGTEDSGDYCNPYHAGLALNDdGLLGIRPVMRPRGIDLKDGPLFAALIAKVQGKNVGIPVCGGAATSKSPWN 174
                        89**************************************9799************************************************ PP

                VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalaly 183
                        a+elfdlsllege++rewlffd+prrafesgnrkqrslpdy grgwhesrk vmk+f+glkrsyymdpqpsss+ewhl+eyein +dalaly
  GRMZM2G111696_P03 175 APELFDLSLLEGESLREWLFFDTPRRAFESGNRKQRSLPDYGGRGWHESRKLVMKDFAGLKRSYYMDPQPSSSHEWHLFEYEINASDALALY 266
                        ******************************************************************************************** PP

                VOZ 184 rlelklvdekks.akgkvskdsladlqkklgrlta 217
                        rle+k++d kk  ak+k++ ++l+++++++grlta
  GRMZM2G111696_P03 267 RLEYKSSDPKKGaAKSKLA-SPLNEIRQRMGRLTA 300
                        ********99962677775.79***********97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MYYTDYELNI DDFLCGDGYK INISGSNEDQ FNNLHGIGQL GHQQFDLPLD LPPTHSYADA  60
NNSEQNTGDV FVHMSDLLTT IWPSPSQYLG PKCALWDCGR PAGGTEDSGD YCNPYHAGLA  120
LNDDGLLGIR PVMRPRGIDL KDGPLFAALI AKVQGKNVGI PVCGGAATSK SPWNAPELFD  180
LSLLEGESLR EWLFFDTPRR AFESGNRKQR SLPDYGGRGW HESRKLVMKD FAGLKRSYYM  240
DPQPSSSHEW HLFEYEINAS DALALYRLEY KSSDPKKGAA KSKLASPLNE IRQRMGRLTA  300
DSPVENKRTA RSKPKANQNQ KDTNANTRPH VNTPNQVNAP NAYQTTQQVN QMAFLNGNVV  360
YGPHLPHSES VVYGPHLPHS ENVVYGPHLP HSENVVYGPH LPQGYSAEGS SFFWNPSDGT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.198550.0aerial organ| ear| embryo| endosperm| leaf| meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G111696
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G111696_P03
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0396290.0BT039629.1 Zea mays full-length cDNA clone ZM_BFc0035D15 mRNA, complete cds.
GenBankBT0552840.0BT055284.1 Zea mays full-length cDNA clone ZM_BFc0117C20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105277.20.0expressed protein DH12
SwissprotQ9SGQ01e-106VOZ1_ARATH; Transcription factor VOZ1
TrEMBLB4FR910.0B4FR91_MAIZE; Transcription factor VOZ1
STRINGGRMZM2G111696_P010.0(Zea mays)
STRINGGRMZM2G158717_P030.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-103vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]