PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G110582_P04 | ||||||||
Common Name | MADS71, si603017c03(382), ZEAMMB73_814205 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 187aa MW: 20930.1 Da PI: 10.596 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 48.8 | 8.7e-16 | 15 | 59 | 2 | 46 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46 ie+ + qvtfskR+ g+ KKA+EL LC+ va++ifs+ k+ GRMZM2G110582_P04 15 HIEDGGRLQVTFSKRKSGLQKKASELFLLCGSPVAIVIFSPGKKV 59 58999999********************************98887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 8.3E-20 | 6 | 65 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 22.413 | 6 | 66 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.75E-22 | 7 | 81 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-15 | 8 | 28 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-17 | 16 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-15 | 28 | 43 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-15 | 43 | 64 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MGRPSRGRQR IEIRHIEDGG RLQVTFSKRK SGLQKKASEL FLLCGSPVAI VIFSPGKKVF 60 ALGTPSVDHV LRRYAPIPGE EEEDGLLPVL QDTDDVSAIT DRVEVEGIVR RTEETKARSV 120 MEKARMDAIG KTVRQTAAKA GRKFWWEADS GKLGEAELPE FAKVLRRLRV NLQRHLDSLS 180 ASTRQLQ |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G110582 |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G110582_P04 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT041742 | 0.0 | BT041742.2 Zea mays full-length cDNA clone ZM_BFb0042I18 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001141627.2 | 1e-133 | uncharacterized protein LOC100273746 | ||||
Refseq | XP_008658273.1 | 1e-133 | putative MADS-box transcription factor family protein isoform X1 | ||||
TrEMBL | B4FXA4 | 1e-131 | B4FXA4_MAIZE; MADS transcription factor | ||||
STRING | GRMZM5G878490_P01 | 1e-106 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 4e-28 | AGAMOUS-like 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G110582_P04 |
Entrez Gene | 100273746 |