PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G110135_P01 | ||||||||
Common Name | LOC100382484 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 314aa MW: 34045.1 Da PI: 6.032 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.3 | 1.7e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+l++++++ G g+W+t +r g++R++k+c++rw +yl GRMZM2G110135_P01 14 KGPWTQEEDEKLLHYIQKNGHGSWRTLPRLAGLNRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.2 | 1.4e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++ eE++ +++++ lG++ W++Ia +++ gRt++++k++w+++l GRMZM2G110135_P01 67 RGKFSREEEQTILHLHSVLGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 6.5E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.38 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.62E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.46E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.409 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.2E-27 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.4E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.27E-12 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 314 aa Download sequence Send to blast |
MGRSPCCDEN GLKKGPWTQE EDEKLLHYIQ KNGHGSWRTL PRLAGLNRCG KSCRLRWTNY 60 LRPDIKRGKF SREEEQTILH LHSVLGNKWS AIATHLPGRT DNEIKNFWNT HLRKRLIQMG 120 FDPMTHRPRT DFFAALPQLI ALAALRGQLP ADPDPPQQAG TTAAALAGLI GALCSPQLTL 180 LDTTTTTTAA AAPPVVSSSS ADDDAAHQYY LPRTTFPDAP GSGEAAHQRQ QQAAGLISYG 240 RRPDDDDGGD VDVFACYGAG GGGSSLPPLT DLSDDAATLL QVDTASSQFG SGGSIPLLPW 300 PEFFPDDPFI TDFL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 7e-28 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G110135 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Specifically and transiently expressed in root endodermal cells overlying the early stages of lateral root primordia formation. {ECO:0000269|PubMed:24902892, ECO:0000269|PubMed:25482809}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G110135_P01 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT064525 | 0.0 | BT064525.1 Zea mays full-length cDNA clone ZM_BFc0177P23 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001168694.1 | 0.0 | uncharacterized protein LOC100382484 | ||||
Swissprot | Q9S9Z2 | 7e-92 | MYB93_ARATH; Transcription factor MYB93 | ||||
TrEMBL | C0P8A6 | 0.0 | C0P8A6_MAIZE; Myb domain protein 93 | ||||
STRING | GRMZM2G110135_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1126 | 37 | 132 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G34670.1 | 7e-85 | myb domain protein 93 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G110135_P01 |
Entrez Gene | 100382484 |
Publications ? help Back to Top | |||
---|---|---|---|
|