PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G106798_P02 | ||||||||
Common Name | LOC100278824, ZEAMMB73_421624 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 325aa MW: 34384 Da PI: 8.4332 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 130.9 | 4.6e-41 | 76 | 152 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 C v+gC++dls+++eyhrrhkvCe+hskapvv+v g+e+rfCqqCsrfh+lsefDeekrsCr+rL++hn+rrrk+q+ GRMZM2G106798_P02 76 CSVDGCRSDLSRCREYHRRHKVCEAHSKAPVVVVGGQERRFCQQCSRFHMLSEFDEEKRSCRKRLDGHNRRRRKPQH 152 **************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 4.5E-33 | 71 | 137 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.265 | 73 | 150 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 8.63E-39 | 75 | 155 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.1E-30 | 76 | 149 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 325 aa Download sequence Send to blast |
MDWAAASGSP SWGAAATDPG PTMLSFAGPS SSAADAEVRL QDFAAGLAQS SRPTGAAPGA 60 GRRSRAAVGG AGAEACSVDG CRSDLSRCRE YHRRHKVCEA HSKAPVVVVG GQERRFCQQC 120 SRFHMLSEFD EEKRSCRKRL DGHNRRRRKP QHDLTNLGGF FPYHQVNQFE FYPQTIPTVG 180 QNSDAVHLVG RQQPFSISFS RTPDEFPFPQ GGGSSVLHHL HAARPGHHAE GSSHTGSSTR 240 DNALSGTLGP ECALSLLSSS LRRPSTAGVP AVGQPQVTAS STTAVSQAAT AAVATAAFAA 300 SAGHHVFVPD AMFEDPSQAL PFSWQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 3e-28 | 69 | 149 | 4 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 132 | 149 | KRSCRKRLDGHNRRRRKP |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.24793 | 0.0 | meristem| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G106798 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G106798_P02 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT064694 | 0.0 | BT064694.1 Zea mays full-length cDNA clone ZM_BFb0036O07 mRNA, complete cds. | |||
GenBank | BT065275 | 0.0 | BT065275.1 Zea mays full-length cDNA clone ZM_BFb0077F03 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001352598.1 | 0.0 | SBP-transcription factor 3 | ||||
Refseq | XP_008677050.1 | 0.0 | squamosa promoter-binding protein-like (SBP domain) transcription factor family protein isoform X2 | ||||
Swissprot | Q2R3Y1 | 1e-86 | SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19 | ||||
TrEMBL | C0P8S5 | 0.0 | C0P8S5_MAIZE; SBP transcription factor | ||||
STRING | GRMZM2G106798_P01 | 0.0 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50670.1 | 1e-38 | SBP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G106798_P02 |
Entrez Gene | 100278824 |
Publications ? help Back to Top | |||
---|---|---|---|
|