PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G106560_P02 | ||||||||
Common Name | Zm.9674 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 76aa MW: 8852.88 Da PI: 8.1032 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 59.7 | 5.7e-19 | 2 | 42 | 19 | 59 |
SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 19 efprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ++ rsYYrCt++gC+vkk+v+r ++d+ vv++tYeg+H+h+ GRMZM2G106560_P02 2 PCQRSYYRCTHQGCNVKKQVQRLSRDEGVVVTTYEGTHTHP 42 578*************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 18.051 | 1 | 44 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.4E-12 | 2 | 43 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.1E-16 | 2 | 43 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 3.4E-17 | 2 | 42 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.3E-15 | 2 | 42 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MPCQRSYYRC THQGCNVKKQ VQRLSRDEGV VVTTYEGTHT HPIEKSNDNF EHILTQMQIY 60 SGMGSTFSRS SHDMFH |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G106560 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G106560_P02 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728200 | 1e-116 | KJ728200.1 Zea mays clone pUT6475 WRKY transcription factor (WRKY108) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008670731.2 | 9e-48 | probable WRKY transcription factor 45 | ||||
Swissprot | Q9FYA2 | 2e-28 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A060CYT2 | 2e-46 | A0A060CYT2_MAIZE; WRKY transcription factor (Fragment) | ||||
TrEMBL | A0A1D6F5K4 | 2e-46 | A0A1D6F5K4_MAIZE; Putative WRKY transcription factor 75 | ||||
TrEMBL | A0A3L6FS40 | 2e-46 | A0A3L6FS40_MAIZE; Putative WRKY transcription factor 75 | ||||
STRING | GRMZM2G106560_P01 | 3e-47 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 8e-31 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G106560_P02 |