PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G105004_P01
Common NameLOC100191188, ZEAMMB73_961517
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Nin-like
Protein Properties Length: 945aa    MW: 102830 Da    PI: 6.4763
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G105004_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.45.2e-27567617252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek+ sl++l+kyFs++++dAA +Lgvc+T+LKriCRq+GI+RWP+Rki+++
  GRMZM2G105004_P01 567 EKNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKINKV 617
                        899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.006556637IPR003035RWP-RK domain
PfamPF020421.5E-24570617IPR003035RWP-RK domain
SuperFamilySSF542771.26E-22836928No hitNo description
Gene3DG3DSA:3.10.20.2401.7E-21839921No hitNo description
PROSITE profilePS5174523.473842924IPR000270PB1 domain
SMARTSM006661.7E-20842929IPR000270PB1 domain
PfamPF005648.7E-17843923IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 945 aa     Download sequence    Send to blast
MDVPTPPNRA GCNSNIGSPM QSFDDPFGVA AMTSFDGYSE LCSPSVADHI FSLLNDPSAA  60
QQMVAMWSSL GSSPRASAVR EDMSFDTFPG PVDGTSSLAQ RFNSAAASSP TGVDRGLKES  120
DGLVLPSNGS QQGSSIIPRS VGNALADRML MALSLFRKSL SDGVLAQVWM PVEHNGRVVL  180
STSEQPYLLD QDLAGYREVS RNFLFSVKEE PGLHLGLPGR VFISGVPEWT SSVIYYSKPE  240
YLRMEHALLH EIQGSLAMPV YDPSKGSCCA VLELVTNKEK PNFDAEMDIV CDALQAVNLQ  300
TTTDRSNQKV YSENQKSAFT EILDVLRAIC HAHMLPLALT WVPTSNGIAN GFCVGKNIGI  360
DPQPGKAALR IHESACYVND AKMQGFLHAC ADRHLEKGQG IAGRALKSNL PFFSPDIREY  420
SIEDYPLAHH ARKFGLHAAV AIRLRSTYTS YDDYILEFFL PVNCKGCGEQ QMLLNNLSST  480
MQRICKSLRT VSEAEIENVS ATAAMFEKTS GTCLPTGNSE SSSHDDQPIT ESALQDLSLG  540
DKQGDREPDK PQRSSMRVAD KKRSASEKNF SLDVLRKYFS GSLRDAAMSL GVCPTTLKRI  600
CRQHGISRWP SRKINKVNRS LKKIEKVIKS VHGVDRSLQY DPATGSLVPA TSLPEKMPFS  660
ACDTLPTSSL GRAVEETCSP KSEQDFSSPD GWQRETSQFH VSGIPKRGGD EVRTLANNNK  720
GRRNYVSGIA NITQHSNSEG THGPSYPNPI GAVNSLHTGE TGNIDSLTSL HPSMDGIEGQ  780
TTVRNSPFVQ QADVTMVDGH DTKEQTLPST SGMTDSSSGS ASSEPTFKGN PGRALKDRSS  840
PALTVKATYN GDTVRFKFVP ARGWYHLLEE IAKRFKLTAG AFQLKYKDDE DEWVILANDA  900
DLQECMDVLD SISSRNMKLQ VRDLSCHVGS SGSSSSCLQV EAHSS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.948830.0embryo| endosperm| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G105004
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G105004_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277560.0KJ727756.1 Zea mays clone pUT5699 NLP transcription factor (NLP3) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001345299.10.0uncharacterized protein LOC100191188
SwissprotQ0JC270.0NLP2_ORYSJ; Protein NLP2
TrEMBLA0A1D6J9B50.0A0A1D6J9B5_MAIZE; Protein NLP8
STRINGGRMZM2G105004_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.21e-180Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]