PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G104551_P03 | ||||||||
Common Name | cl51309_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 275aa MW: 30052.5 Da PI: 5.4046 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.5 | 2e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd +l++ + G +W+++++ g+ R++k+c++rw +yl GRMZM2G104551_P03 14 RGPWTAEEDRKLINFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 61 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 50.8 | 3.9e-16 | 70 | 111 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 T E++ +d++++lG++ W++Ia++++ gRt++++k++w+++ GRMZM2G104551_P03 70 LTDAEEQVVIDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111 5899***************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.8E-21 | 5 | 62 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 13.085 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.59E-26 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.4E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.29E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.536 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-25 | 63 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.5E-14 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.1E-14 | 70 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.96E-11 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 275 aa Download sequence Send to blast |
MGRQPCCDKL GVKRGPWTAE EDRKLINFIL TNGHCCWRAV PKLAGLLRCG KSCRLRWTNY 60 LRPDLKRGLL TDAEEQVVID LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG 120 IDPVTHEPLD RKTTSSGPAT TSQSTKSDEA TKEQSPQNDD AVIRDVPADG CSPTESSTNT 180 VSTGGSSSSG GGGHDQDPLV KWLLEEEPAT GDEAWLNFTG SVDVDEFSSI AAGPELLPWD 240 GATDWLLDYQ DFGLGDSSLV DGYMVNNNSS NGAKF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-27 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.102687 | 0.0 | ear| meristem| shoot| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G104551 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in mature flowers and decreases upon pollination. {ECO:0000269|PubMed:15805488}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to the petals, with the highest expression in the limb. {ECO:0000269|PubMed:15805488}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G104551_P03 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT041771 | 0.0 | BT041771.1 Zea mays full-length cDNA clone ZM_BFb0051B11 mRNA, complete cds. | |||
GenBank | BT062437 | 0.0 | BT062437.1 Zea mays full-length cDNA clone ZM_BFb0298A24 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001307849.1 | 0.0 | uncharacterized protein LOC100101510 | ||||
Refseq | XP_008650758.1 | 0.0 | uncharacterized protein LOC100101510 isoform X1 | ||||
Refseq | XP_023156216.1 | 0.0 | uncharacterized protein LOC100101510 isoform X1 | ||||
Swissprot | Q50EX6 | 5e-94 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | B4FXD3 | 0.0 | B4FXD3_MAIZE; Uncharacterized protein | ||||
STRING | GRMZM2G104551_P01 | 0.0 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G12350.1 | 2e-87 | myb domain protein 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G104551_P03 |
Entrez Gene | 100101510 |
Publications ? help Back to Top | |||
---|---|---|---|
|