PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G100318_P01
Common NameZEAMMB73_997394, Zm.162597
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family ARR-B
Protein Properties Length: 598aa    MW: 66358.2 Da    PI: 4.9984
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G100318_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like826.6e-26208261155
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+gLt+e+v+SHLQkYRl
  GRMZM2G100318_P01 208 KARVVWSVDLHQKFVNAVNQI-GFDKVGPKKILDLMNVHGLTRENVASHLQKYRL 261
                        68*******************.9*******************************8 PP

2Response_reg394.3e-145715126109
                        EEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHH.HHHT........TTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHH CS
       Response_reg  26 vaeaddgeealellkekd..pDlillDiempgmdGlellkei.reee........pklpiivvtahgeeedalealkaGakdflsKpfdpee 106
                        v+++  ++ al++l+e++  +D+++ D++mp+mdG++ll+ i  e +         +    v++  ge + + + ++ Ga d+l Kp+ ++e
  GRMZM2G100318_P01  57 VTTCGLASVALQILRERRnkFDIVISDVNMPDMDGFKLLELIgLEMDlpvistklLQSVSTVMSIDGETSRVMKGVHHGACDYLLKPVRMKE 148
                        44666778899999888788**********************666666554433323444589999************************** PP

                        HHH CS
       Response_reg 107 lvk 109
                        l++
  GRMZM2G100318_P01 149 LRN 151
                        987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363927.7E-1432592IPR017053Response regulator B-type, plant
SuperFamilySSF521721.42E-2212163IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.0E-3412183No hitNo description
SMARTSM004481.5E-1713153IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011032.16114157IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.1E-1215152IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.80E-2016156No hitNo description
SuperFamilySSF466898.96E-18205265IPR009057Homeodomain-like
PROSITE profilePS5129410.174205264IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-28206266IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-22208261IPR006447Myb domain, plants
PfamPF002499.5E-8210260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MALADATAFP YGLRVLVVDD DPTWLKILEK MLRKCSYEDA MSDRTVIART GGISSCVTTC  60
GLASVALQIL RERRNKFDIV ISDVNMPDMD GFKLLELIGL EMDLPVISTK LLQSVSTVMS  120
IDGETSRVMK GVHHGACDYL LKPVRMKELR NIWQHVYRKK MHEVKEIEDG LDERGLFMRA  180
DTDTMRKRKE VDKDHADQDS SDGATAKKAR VVWSVDLHQK FVNAVNQIGF DKVGPKKILD  240
LMNVHGLTRE NVASHLQKYR LYLSRLQKQN EERIMGAARQ DFNQKGPSDN LNLRSSFQEQ  300
PGNLTNGFQH SSQKVQSQTN ILDPHLDDTK TSVPLKVPDK NGTSASDAAD HQNITGVSPL  360
GGGGVFSFER MPVNQDTKLS EAMILECQSW SGGVPPKQFM QYPKHNHERC DLLGDYSCLP  420
KPDLEHPIAP SHLYAPPPVI SMSCSVEGDV RDFSDVKPDL LGCMKSLSPA LTCTVESVSA  480
QLSDSVVSST NNDKKISSVE GLSSVKDCDF DQERNQAILL TSEEASILCS TDLTCLPDEL  540
SGYQLQGVSF GDIGLNSIDL FQCNDTMVLP GLQNNWYDDP DFSNETMEFP LLDGGLFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-17207266463ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.979510.0cell culture| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G100318
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G100318_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9747740.0EU974774.1 Zea mays clone 457889 two-component response regulator ARR11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656969.10.0two-component response regulator ORR26
SwissprotQ5N6V80.0ORR26_ORYSJ; Two-component response regulator ORR26
TrEMBLA0A1D6G6S90.0A0A1D6G6S9_MAIZE; Two-component response regulator
STRINGGRMZM2G100318_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59003752
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-100response regulator 11
Publications ? help Back to Top
  1. Du L, et al.
    The two-component signal system in rice (Oryza sativa L.): a genome-wide study of cytokinin signal perception and transduction.
    Genomics, 2007. 89(6): p. 697-707
    [PMID:17408920]