PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G099797_P02
Common NameRR8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family ARR-B
Protein Properties Length: 684aa    MW: 73429.6 Da    PI: 6.8866
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G099797_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.92.2e-28200253155
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        kpr++W+ eLH++Fv+av++L G++kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  GRMZM2G099797_P02 200 KPRVVWSVELHQQFVNAVNHL-GIDKAVPKKILELMNVPGLTRENVASHLQKFRL 253
                        79*******************.********************************8 PP

2Response_reg77.54.8e-26171251109
                        EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHH CS
       Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedaleal 90 
                        vl+vdD+p+ + +l+++l + +y +v+++ +++ al++l+e++  +D+i+ D+ mp+mdG++ll+     e++lp+i+++a +  + + + +
  GRMZM2G099797_P02  17 VLVVDDDPTCLVVLKRMLLECRY-DVTTCPQATRALTMLRENRrgFDVIISDVHMPDMDGFRLLELVGL-EMDLPVIMMSADSRTDIVMKGI 106
                        89*********************.***************99999********************87754.558******************* PP

                        HTTESEEEESS--HHHHHH CS
       Response_reg  91 kaGakdflsKpfdpeelvk 109
                        k Ga d+l Kp+ +eel +
  GRMZM2G099797_P02 107 KHGACDYLIKPVRMEELKN 125
                        ****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.2E-1791668IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.5E-4114149No hitNo description
SuperFamilySSF521725.69E-3614135IPR011006CheY-like superfamily
SMARTSM004484.7E-3015127IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.19616131IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.1E-2317125IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.32E-2718130No hitNo description
Gene3DG3DSA:1.10.10.601.1E-29197258IPR009057Homeodomain-like
SuperFamilySSF466899.14E-20197257IPR009057Homeodomain-like
PROSITE profilePS5129411.674197256IPR017930Myb domain
TIGRFAMsTIGR015573.0E-25200253IPR006447Myb domain, plants
PfamPF002497.8E-7202251IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MAAAEARGAD FPVGMKVLVV DDDPTCLVVL KRMLLECRYD VTTCPQATRA LTMLRENRRG  60
FDVIISDVHM PDMDGFRLLE LVGLEMDLPV IMMSADSRTD IVMKGIKHGA CDYLIKPVRM  120
EELKNIWQHV VRKKFNGNKD HEHSGSLDDT DRNRPTNNDN EYASSANDGG DGSWKSQKKK  180
REKEDDETDL ESGDPSTSKK PRVVWSVELH QQFVNAVNHL GIDKAVPKKI LELMNVPGLT  240
RENVASHLQK FRLYLKRIAQ HHAGIPHPFV ASASSAKVAP LGGLEFQALA ASGQIPPQAL  300
AALQDELLGR PTSSLALPGR DQSSLRLAAI KGNKPHGERE IAFGQPIYKC QNNTYGAFSQ  360
SSPAVGGLPS FAAWPNNKLG MTDSSNTLGN VGNSQNSNML LHELQQQPDT LLSGTLHNID  420
VKPSGVVMPS QSLNVFPASE GISHNQNPLV IPSQSPSFLA SVPPSMKHES LLGSPSPSTS  480
LLGGLDMVNQ ASTSQPLISS HGANLPGLMN RSSNAMPSPG ISNFQSGNIP YVVTQNAMGV  540
SSRPPGVLKT ECTESLTHSY GYIGGSTSVD SSLLSSQAKN PQYGLLQSQN DVSSSWLSSQ  600
DFDSFGNSLG QGHPGSTSSS FQSSALGKLP DQGRGRNHGF VGKGTCIPSR FAVDEVGSPT  660
NLSHNIVNSG DIVNPDIFGF SGQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-24196259164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.59320.0meristem| ovary| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G099797
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G099797_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0601300.0AB060130.1 Zea mays ZmRR8 mRNA for response regulator 8, complete cds.
GenBankEU9755450.0EU975545.1 Zea mays clone 492147 two-component response regulator ARR1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001104861.20.0response regulator 8
SwissprotA2XE310.0ORR21_ORYSI; Two-component response regulator ORR21
TrEMBLA0A096RK270.0A0A096RK27_MAIZE; Two-component response regulator
STRINGGRMZM2G099797_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-114response regulator 2