PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G098813_P04 | ||||||||
Common Name | ZEAMMB73_199317, zfl1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | LFY | ||||||||
Protein Properties | Length: 268aa MW: 29444.6 Da PI: 10.1322 | ||||||||
Description | LFY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FLO_LFY | 392.6 | 5e-120 | 18 | 256 | 157 | 386 |
FLO_LFY 157 ekeaagsgge.glgeaelvaaeekkseeekkkaskk.kqkrkkkkelkse........ededeeeeededeegsgedgeerqrehPfivtep 238 e++aa+sgg+ +gea+ +++++ ++ kk + k k+ ++k+ + + +d de +e++e+s+ ++ erqrehPf+vtep GRMZM2G098813_P04 18 ERDAAASGGGmAEGEAGRRMVTTTAGKKGKKGVVGTrKGKKARRKK-ELRplnvlddeNDGDEYGGGSESTESSAGGSGERQREHPFVVTEP 108 4455555443034444444444332222222222221222222222.12234554322222222223334444555556************* PP FLO_LFY 239 gevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkerg 330 gevar+kknGLDYLf+LyeqCr fLlqvq+iak G+k+Ptkvtnqvfrya+k+gasyinkPkmrhYvhCYalhcLdeeasnalrra+k rg GRMZM2G098813_P04 109 GEVARAKKNGLDYLFHLYEQCRVFLLQVQSIAKLGGHKSPTKVTNQVFRYANKCGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKSRG 200 ******************************************************************************************** PP FLO_LFY 331 envGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386 envGawrqacy+plv+iaar+g+didavf+ahprL++WYvPt+LrqLCh++r +++ GRMZM2G098813_P04 201 ENVGAWRQACYAPLVEIAARHGFDIDAVFAAHPRLAVWYVPTRLRQLCHQARGSHA 256 ****************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF01698 | 6.7E-130 | 15 | 256 | IPR002910 | Floricaula/leafy protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0031490 | Molecular Function | chromatin DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0043621 | Molecular Function | protein self-association |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 268 aa Download sequence Send to blast |
MLLALVRSYR KLAALSDERD AAASGGGMAE GEAGRRMVTT TAGKKGKKGV VGTRKGKKAR 60 RKKELRPLNV LDDENDGDEY GGGSESTESS AGGSGERQRE HPFVVTEPGE VARAKKNGLD 120 YLFHLYEQCR VFLLQVQSIA KLGGHKSPTK VTNQVFRYAN KCGASYINKP KMRHYVHCYA 180 LHCLDEEASN ALRRAYKSRG ENVGAWRQAC YAPLVEIAAR HGFDIDAVFA AHPRLAVWYV 240 PTRLRQLCHQ ARGSHAHAAA GLPPPPMF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2vy1_A | 1e-100 | 96 | 254 | 4 | 162 | PROTEIN LEAFY |
2vy2_A | 1e-100 | 96 | 254 | 4 | 162 | PROTEIN LEAFY |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.6788 | 0.0 | ear| meristem| shoot| tassel |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G098813 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In the vegetative phase, expressed in shoot meristems and leaf primordia. In the reproductive phase, present in the meristems of primary and secondary branches at primordial and elongating stages, but later transiently down-regulated from the meristems, when the meristem identity change from inflorescence to spikelet. Subsequent expression recovery when spikelets are differentiated, with an accumulation in floral meristems and in primordia of all floral organs, including lodicules, stamens, carpels and ovules. {ECO:0000269|PubMed:21910771}. | |||||
Uniprot | TISSUE SPECIFICITY: In very young panicle but not in mature florets, mature leaves, roots or apical meristems. {ECO:0000269|PubMed:9482818}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00095 | SELEX | Transfer from AT5G61850 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G098813_P04 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY179882 | 0.0 | AY179882.1 Zea mays cultivar A632 floricaula/leafy-like 1 (fl1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001105201.1 | 0.0 | zea floricaula/leafy 1 | ||||
Swissprot | Q0JAI1 | 1e-125 | FL_ORYSJ; Probable transcription factor FL | ||||
TrEMBL | A0A3L6GDN3 | 0.0 | A0A3L6GDN3_MAIZE; Putative transcription factor FL | ||||
TrEMBL | Q84QG7 | 0.0 | Q84QG7_MAIZE; Floricaula/leafy-like 1 (Fragment) | ||||
TrEMBL | Q84QG8 | 0.0 | Q84QG8_MAIZE; Floricaula/leafy-like 1 | ||||
STRING | GRMZM2G098813_P01 | 0.0 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61850.1 | 3e-98 | floral meristem identity control protein LEAFY (LFY) |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G098813_P04 |