PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G097636_P01
Common NameLOC100037740, ZEAMMB73_066452, Zm.92943
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 382aa    MW: 40650.7 Da    PI: 4.8629
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G097636_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161663148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  GRMZM2G097636_P01 16 KGSWTPEEDMRLIAYIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                       799*****************************99************97 PP

2Myb_DNA-binding538.1e-1769114148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg++T+eE+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  GRMZM2G097636_P01  69 RGNFTAEEEEAIIKLHGLLGNK-WSKIASCLP-GRTDNEIKNVWNTHL 114
                        89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-24766IPR009057Homeodomain-like
PROSITE profilePS5129415.1951163IPR017930Myb domain
SuperFamilySSF466891.8E-3013110IPR009057Homeodomain-like
SMARTSM007172.3E-131565IPR001005SANT/Myb domain
PfamPF002493.0E-151663IPR001005SANT/Myb domain
CDDcd001673.43E-111863No hitNo description
PROSITE profilePS5129424.9764118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-2667117IPR009057Homeodomain-like
SMARTSM007172.9E-1568116IPR001005SANT/Myb domain
PfamPF002499.8E-1569114IPR001005SANT/Myb domain
CDDcd001677.30E-1271114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009084anatomypericarp
PO:0020040anatomyleaf base
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNKGSWT PEEDMRLIAY IQKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTAEEEEAI IKLHGLLGNK WSKIASCLPG RTDNEIKNVW NTHLKKRVSP  120
AGEERGAAGS KKKKKKKTTK AAAGGGAEAP LPLPSPSPSS STTTTNFSSG DSGEQQSNNM  180
SKEADDELDL ENFEMMPMLD VDDPSFGFGT LVDTAPAPYG SAVSVSASAA TSPCASSTSP  240
PPASAPPGVD DLLVLPEIDM GHELWSIIDG DAAEAPAPRC QRNPAEPTNG ADAGSHGAEG  300
KEWWLEDLER ELGLWGTVED YQYPMGPQGL LVADHPDPLP AMVDDPVSCY FQAGPASAVL  360
QELPGYPVPA TAVTGSINQM GL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-29141182105C-Myb DNA-Binding Domain
1msf_C9e-29141182105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114136KKRVSPAGEERGAAGSKKKKKKK
2130136KKKKKKK
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G097636
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G097636_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0701450.0BT070145.1 Zea mays full-length cDNA clone ZM_BFc0138F01 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008663546.10.0myb-related protein Zm1-like
SwissprotP200241e-105MYB1_MAIZE; Myb-related protein Zm1
TrEMBLK7TN710.0K7TN71_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G097636_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.19e-69myb domain protein 63
Publications ? help Back to Top
  1. Rabinowicz PD,Braun EL,Wolfe AD,Bowen B,Grotewold E
    Maize R2R3 Myb genes: Sequence analysis reveals amplification in the higher plants.
    Genetics, 1999. 153(1): p. 427-44
    [PMID:10471724]
  2. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]