PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G094081_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family VOZ
Protein Properties Length: 309aa    MW: 35202.9 Da    PI: 8.5223
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G094081_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ345.13.2e-10642272217
                VOZ   2 ppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgke.vgipec.....egaata 86 
                        +psafl+pkcalwdc rpa gse+++dycs++ha+la++e g+pgt+pv+rp+gidlkdg+lf alsak   k+ +g  +      +    +
  GRMZM2G094081_P01   4 APSAFLKPKCALWDCLRPAVGSERWHDYCSMYHADLAVQEeGPPGTMPVIRPRGIDLKDGPLFTALSAKNIRKKmLGSLSVkelplQSLRGM 95 
                        69************************************9879**************************976554156444311111345567 PP

                VOZ  87 kspwn.aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeinel 177
                        + p+   aelfdl ++ege+irewlffdkprraf sgnrkqrsl dy grgwhesrkq mk+fgglkrsyymdpqps+s+ewhlyeyeine+
  GRMZM2G094081_P01  96 HLPFCtIAELFDLYIFEGESIREWLFFDKPRRAFVSGNRKQRSLLDYGGRGWHESRKQAMKDFGGLKRSYYMDPQPSNSYEWHLYEYEINEC 187
                        78885269************************************************************************************ PP

                VOZ 178 dalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                        da+alyrle+k++d+kk++k+k+ +++++++q++++rl+a
  GRMZM2G094081_P01 188 DAFALYRLEFKSSDAKKTVKSKLVCNPMNEIQQQMVRLSA 227
                        **************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MTSAPSAFLK PKCALWDCLR PAVGSERWHD YCSMYHADLA VQEEGPPGTM PVIRPRGIDL  60
KDGPLFTALS AKNIRKKMLG SLSVKELPLQ SLRGMHLPFC TIAELFDLYI FEGESIREWL  120
FFDKPRRAFV SGNRKQRSLL DYGGRGWHES RKQAMKDFGG LKRSYYMDPQ PSNSYEWHLY  180
EYEINECDAF ALYRLEFKSS DAKKTVKSKL VCNPMNEIQQ QMVRLSANSP VDNKRTARGR  240
PHANPTDVDT NIYSVPNTTA QANVPNAFQP GSEVDQMTYL NGSVVYGPHL SYGYSTERSY  300
FYWNSADGT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.270970.0leaf| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G094081
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G094081_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0557050.0BT055705.1 Zea mays full-length cDNA clone ZM_BFb0126K15 mRNA, complete cds.
GenBankBT0671960.0BT067196.1 Zea mays full-length cDNA clone ZM_BFb0282C22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001146575.10.0Transcription factor VOZ1
SwissprotQ9SGQ07e-90VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1D6MUN70.0A0A1D6MUN7_MAIZE; Transcription factor VOZ1
STRINGGRMZM2G094081_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Representative plantOGRP23271335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.23e-92vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]