PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G092465_P03 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 185aa MW: 20645.4 Da PI: 9.5343 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 171.7 | 2.2e-53 | 11 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkd 89 +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++ k+ + +++wyfFs++dkky+tg+r+nrat++g+Wkatg+d GRMZM2G092465_P03 11 VPPGFRFHPTEEELLNYYLRKKVASQEIDL-DVIRDVDLNKLEPWDIQEkcKIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRD 101 69****************************.9***************952444443456********************************* PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 k++++ + +g++ktLvfykgrap+g+k+dW+mheyrl GRMZM2G092465_P03 102 KAIYN-AVKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139 *****.8899***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.59E-55 | 7 | 144 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 52.131 | 11 | 166 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.0E-29 | 12 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASQEIDL DVIRDVDLNK LEPWDIQEKC 60 KIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYNAVKR IGMRKTLVFY 120 KGRAPHGQKS DWIMHEYRLD DPAAAAAAGS GDAVANDDAA ATVSKATTLI AVNLFSAPPV 180 HVRHH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-47 | 8 | 143 | 14 | 146 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-47 | 8 | 143 | 14 | 146 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-47 | 8 | 143 | 14 | 146 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-47 | 8 | 143 | 14 | 146 | NO APICAL MERISTEM PROTEIN |
3swm_A | 6e-47 | 8 | 143 | 17 | 149 | NAC domain-containing protein 19 |
3swm_B | 6e-47 | 8 | 143 | 17 | 149 | NAC domain-containing protein 19 |
3swm_C | 6e-47 | 8 | 143 | 17 | 149 | NAC domain-containing protein 19 |
3swm_D | 6e-47 | 8 | 143 | 17 | 149 | NAC domain-containing protein 19 |
3swp_A | 6e-47 | 8 | 143 | 17 | 149 | NAC domain-containing protein 19 |
3swp_B | 6e-47 | 8 | 143 | 17 | 149 | NAC domain-containing protein 19 |
3swp_C | 6e-47 | 8 | 143 | 17 | 149 | NAC domain-containing protein 19 |
3swp_D | 6e-47 | 8 | 143 | 17 | 149 | NAC domain-containing protein 19 |
4dul_A | 5e-47 | 8 | 143 | 14 | 146 | NAC domain-containing protein 19 |
4dul_B | 5e-47 | 8 | 143 | 14 | 146 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G092465 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in various aboveground tissues undergoing thickening of the lignified secondary wall such as anthers, filaments of stamens, the base of carpels, styles, the boundaries between siliques and pedicels, the midrib of leaf veins, and inflorescence stems, specifically in interfascicular fibers (sclerenchyma), cells differentiating into vascular vessels, and xylary fibers (secondary xylem). {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G092465_P03 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT075081 | 0.0 | KT075081.1 Panicum virgatum secondary wall NAC master switch (SWN2A) mRNA, complete cds. | |||
GenBank | KT075082 | 0.0 | KT075082.1 Panicum virgatum secondary wall NAC master switch (SWN2B) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008648393.1 | 1e-119 | NAC domain-containing protein 43 | ||||
Swissprot | Q84WP6 | 1e-93 | NAC43_ARATH; NAC domain-containing protein 43 | ||||
TrEMBL | A0A3L6EK99 | 1e-118 | A0A3L6EK99_MAIZE; NAC domain-containing protein 43 | ||||
STRING | GRMZM2G092465_P01 | 1e-119 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46770.1 | 2e-82 | NAC family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G092465_P03 |