PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G091201_P01
Common NameLOC100285249, LOC103630399
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 185aa    MW: 20551.7 Da    PI: 8.837
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G091201_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.5e-14117161347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT++E+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qky
  GRMZM2G091201_P01 117 PWTEDEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKY 161
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071721971IPR001005SANT/Myb domain
SuperFamilySSF466891.09E-102175IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-42262IPR009057Homeodomain-like
PROSITE profilePS500906.6322269IPR017877Myb-like domain
PROSITE profilePS5129419.046110166IPR017930Myb domain
SuperFamilySSF466896.39E-18112166IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-17114165IPR006447Myb domain, plants
SMARTSM007173.6E-10114164IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-11116160IPR009057Homeodomain-like
PfamPF002494.1E-11117161IPR001005SANT/Myb domain
CDDcd001671.11E-10117162No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MAFYYGVGGQ SSAWAAPGGS RPWTKAEDKV FEGALVMFPE HLPNRWALVA SRLYDRTPQE  60
AWDHYQALVT DVDLIERGMV EAPDSWDDDA AAAGGGRSGR GRGGGSGSGE ERRRGVPWTE  120
DEHRLFLEGL EKYGRGDWRN ISRWSVKTRT PTQVASHAQK YFIRQASAAS RGDSKRKSIH  180
DITTP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-131884672RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.181320.0ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G091201
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G091201_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9714050.0EU971405.1 Zea mays clone 363908 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008649677.11e-133DNA binding protein
SwissprotQ8S9H77e-48DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A1D6M5311e-132A0A1D6M531_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G091201_P011e-132(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-45MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]
  3. Li C, et al.
    Genome-wide characterization of cis-acting DNA targets reveals the transcriptional regulatory framework of opaque2 in maize.
    Plant Cell, 2015. 27(3): p. 532-45
    [PMID:25691733]
  4. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]