PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G088524_P02 | ||||||||
Common Name | LOC100216850 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 221aa MW: 24851.2 Da PI: 9.095 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48 | 2.8e-15 | 98 | 142 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++d+ +qlG+g+W+ I++ + ++Rt+ q+ s+ qky GRMZM2G088524_P02 98 PWTEEEHRKFLDGLRQLGKGDWRGISKGFVTTRTATQVASHAQKY 142 7*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.86 | 90 | 147 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.82E-18 | 93 | 147 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 5.2E-18 | 94 | 146 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 2.9E-10 | 95 | 145 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.5E-11 | 96 | 141 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.2E-12 | 98 | 142 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.62E-10 | 98 | 143 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 221 aa Download sequence Send to blast |
MDMDRPEEEG QQRRETMTPV LLRLFGVDVH RGGGSGEPEE SPMDLRKSSS MPDLTINPLL 60 SPEEKEGCKG YASDDAELAS GQQKRRRRKA QDRKKGIPWT EEEHRKFLDG LRQLGKGDWR 120 GISKGFVTTR TATQVASHAQ KYFLRQTNPG MKKRRASLFD VGIADYKDNQ VPGPQSIVAA 180 KPAPTQEIIH TDRGDVPVIY ILLPLCFLLV LVVTENPRSE Q |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 83 | 88 | KRRRRK |
2 | 83 | 94 | KRRRRKAQDRKK |
3 | 84 | 94 | RRRRKAQDRKK |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.7675 | 0.0 | endosperm| glume| shoot| silk |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G088524 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed mainly in roots, leaves, and senescent leaves at similar levels. {ECO:0000269|PubMed:12172034}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000269|PubMed:12172034}. | |||||
UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q7XC51}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G088524_P02 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by sucrose. Slightly repressed by gibberellic acid (GA). {ECO:0000269|PubMed:12172034}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT037447 | 0.0 | BT037447.1 Zea mays full-length cDNA clone ZM_BFb0169J18 mRNA, complete cds. | |||
GenBank | KJ727538 | 0.0 | KJ727538.1 Zea mays clone pUT5398 MYB-related transcription factor (MYBR32) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001136714.1 | 1e-144 | uncharacterized protein LOC100216850 | ||||
Swissprot | B8BI93 | 2e-74 | MYBS2_ORYSI; Transcription factor MYBS2 | ||||
Swissprot | Q7XC51 | 2e-74 | MYBS2_ORYSJ; Transcription factor MYBS2 | ||||
TrEMBL | B4FK09 | 1e-143 | B4FK09_MAIZE; MYB-related transcription factor | ||||
STRING | GRMZM2G088524_P01 | 1e-144 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61620.1 | 6e-31 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G088524_P02 |
Publications ? help Back to Top | |||
---|---|---|---|
|