PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G081930_P01 | ||||||||
Common Name | Zm.126387 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 297aa MW: 32549.4 Da PI: 5.8566 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 160.5 | 6.6e-50 | 10 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 lppGfrF P+deelv++yL kkv++++ ++ evd++ ePw+Lp ++k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+ev GRMZM2G081930_P01 10 LPPGFRFYPSDEELVCHYLYKKVANERAAQ-GTLVEVDLHAREPWELPDAAKLTASEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDREV 100 79*************************776.78***************87788899************************************ PP NAM 93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 s ++++v ++ktLvfy+grap+g+k+ Wvmhe+rl GRMZM2G081930_P01 101 RSPaTRAVVAMRKTLVFYQGRAPNGVKSCWVMHEFRL 137 **977788***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.68E-59 | 8 | 156 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.154 | 10 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.7E-27 | 11 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 297 aa Download sequence Send to blast |
MGLREIESTL PPGFRFYPSD EELVCHYLYK KVANERAAQG TLVEVDLHAR EPWELPDAAK 60 LTASEWYFFS FRDRKYATGS RTNRATKTGY WKATGKDREV RSPATRAVVA MRKTLVFYQG 120 RAPNGVKSCW VMHEFRLDSP HTPPKEDWVL CRVFQKRKDS EQDNGGGSSS PPTFAGASSQ 180 GVVLDLPDDQ QPSMTMAGAY VAVDHHQPGS SAVGFALPPH AQDNGLGDGG LDALLMNGAT 240 MWQYSSSALA DHFPPEEVTA APMMGLGSRG GGDGCSFFYD SGFDDMANMG FPQGWMG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-49 | 1 | 162 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-49 | 1 | 162 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-49 | 1 | 162 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-49 | 1 | 162 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
4dul_A | 5e-49 | 1 | 162 | 4 | 171 | NAC domain-containing protein 19 |
4dul_B | 5e-49 | 1 | 162 | 4 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G081930 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First observed in young embryonic SAM. Later confined to the boundaries between cotyledon primordia and the SAM. In mature embryos, localized around first leaves primordia. Only weakly present in vegetative SAM. In inflorescence, observed at the boundaries between floral organ primordia. In callus, expressed during transition to shoot development, with a progressive restriction to specific areas corresponding to future shoot apex. {ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12492830}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in inflorescence stems, rosette leaves, aerial parts of seedlings, flowers, floral buds and roots. {ECO:0000269|PubMed:11245578}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:12787253, ECO:0000269|PubMed:14617069, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G081930_P01 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17056621, ECO:0000269|PubMed:17287247}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU966431 | 0.0 | EU966431.1 Zea mays clone 294479 NAC domain-containing protein 21/22 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001150296.1 | 0.0 | uncharacterized protein LOC100283926 | ||||
Swissprot | Q9FRV4 | 3e-62 | NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1 | ||||
TrEMBL | A0A1D6E668 | 0.0 | A0A1D6E668_MAIZE; NAC domain-containing protein 21/22 | ||||
STRING | GRMZM2G081930_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP697 | 38 | 166 | Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28530.1 | 1e-81 | NAC domain containing protein 74 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G081930_P01 |