PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G079458_P02 | ||||||||
Common Name | LOC100191782, MYBR21, ZEAMMB73_042104 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 299aa MW: 33065.2 Da PI: 9.3987 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 23 | 1.8e-07 | 30 | 72 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwq 45 WT+ E +++ +a + l +W+ +ar ++ gRt +++s++ GRMZM2G079458_P02 30 WTAAENKQFERALAGLDLCrpDWEEVARAIP-GRTVREVVSHFK 72 ****************99999**********.**********97 PP | |||||||
2 | Myb_DNA-binding | 46.8 | 7e-15 | 140 | 184 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky GRMZM2G079458_P02 140 PWTEEEHRLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 184 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 7.47 | 25 | 79 | IPR017884 | SANT domain |
SMART | SM00717 | 0.11 | 26 | 77 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.52E-8 | 30 | 82 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.12E-6 | 30 | 74 | No hit | No description |
PROSITE profile | PS51294 | 18.9 | 133 | 189 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.38E-18 | 134 | 189 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.2E-17 | 136 | 187 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 3.0E-13 | 137 | 187 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-12 | 137 | 183 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.9E-12 | 140 | 184 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.84E-12 | 140 | 185 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 299 aa Download sequence Send to blast |
MMRETYMDVL PPVDHIAARS NWFPAAARLW TAAENKQFER ALAGLDLCRP DWEEVARAIP 60 GRTVREVVSH FKHLEVDVQQ IESGQVPLPA YGGGASSFTL QWDGYGPGPG DFRHGYRFAG 120 GCGRRHHGRT PEQERKKGVP WTEEEHRLFL LGLKKYGKGD WRNISRNFVQ TRTPTQVASH 180 AQKYFIRLNS GGKDKRRSSI HDITTVNLTD DQPPSPSQSS LITSQSNAPA PSPAPAPAAG 240 ICQVPLAADV KRHGAGTLPF SSPNRTSAVP AYRMEFHDQQ GLQCGPLHDQ LLASQSVLF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 1e-13 | 25 | 91 | 6 | 73 | RADIALIS |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.118762 | 0.0 | cell culture| ear| endosperm| meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G079458 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G079458_P02 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT033986 | 0.0 | BT033986.1 Zea mays full-length cDNA clone ZM_BFc0061A06 mRNA, complete cds. | |||
GenBank | BT034370 | 0.0 | BT034370.1 Zea mays full-length cDNA clone ZM_BFc0165H07 mRNA, complete cds. | |||
GenBank | BT034532 | 0.0 | BT034532.1 Zea mays full-length cDNA clone ZM_BFc0182F07 mRNA, complete cds. | |||
GenBank | BT035883 | 0.0 | BT035883.1 Zea mays full-length cDNA clone ZM_BFb0086O13 mRNA, complete cds. | |||
GenBank | BT060569 | 0.0 | BT060569.1 Zea mays full-length cDNA clone ZM_BFb0017A18 mRNA, complete cds. | |||
GenBank | BT063847 | 0.0 | BT063847.1 Zea mays full-length cDNA clone ZM_BFc0112L18 mRNA, complete cds. | |||
GenBank | BT087296 | 0.0 | BT087296.1 Zea mays full-length cDNA clone ZM_BFb0032A23 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001130679.1 | 0.0 | uncharacterized protein LOC100191782 | ||||
Refseq | XP_008654259.1 | 0.0 | putative MYB DNA-binding domain superfamily protein isoform X1 | ||||
Refseq | XP_008654260.1 | 0.0 | putative MYB DNA-binding domain superfamily protein isoform X1 | ||||
Swissprot | Q8S9H7 | 2e-78 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | B4FA48 | 0.0 | B4FA48_MAIZE; Duplicated homeodomain-like superfamily protein | ||||
STRING | GRMZM2G079458_P04 | 0.0 | (Zea mays) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38090.1 | 6e-68 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G079458_P02 |
Entrez Gene | 100191782 |
Publications ? help Back to Top | |||
---|---|---|---|
|