PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G073826_P01 | ||||||||
Common Name | Zm.15317 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 277aa MW: 30484.3 Da PI: 6.7934 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 40.4 | 7e-13 | 17 | 60 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 ++ W+++Ed++l++a++ +G+ W + ++++ gRt +k++w++ GRMZM2G073826_P01 17 KQDWSEQEDLKLIRAHQIYGSQ-WLKMVKHFP-GRTNHALKEHWRN 60 689*******************.*********.***********98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 2.82E-15 | 5 | 67 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.8E-17 | 7 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.964 | 12 | 66 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-11 | 16 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-11 | 17 | 60 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.86E-10 | 20 | 60 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007015 | developmental stage | radicle emergence stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007022 | developmental stage | seed imbibition stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007112 | developmental stage | 1 main shoot growth stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 277 aa Download sequence Send to blast |
MGLPYRWTRS LDPAIKKQDW SEQEDLKLIR AHQIYGSQWL KMVKHFPGRT NHALKEHWRN 60 RIKGKLNFYL ASGLLEQVPD LEEGGISVPE SSQSEIPKDS QGSADRSGPP PVLRAQPKSK 120 PELPENAGTS GEGTSDSIRL KGPNAHPTEV SEKVLAKSKQ RARARRRLDF LSTPVELKLC 180 TAAASCQRPP QKMDQPGPVA ENISPSDACQ DISQNVPPER ADAITPLAAS NHHSPATPVD 240 PFSLEMHEAN ASDLLDMSYC DGLIIDSPRD PHDGSLM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-11 | 6 | 67 | 48 | 109 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Zm.123978 | 0.0 | ear| endosperm| meristem| pollen| shoot |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G073826 |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G073826_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU952904 | 0.0 | EU952904.1 Zea mays clone 1341560 hypothetical protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008645512.1 | 0.0 | transcription factor MYB3R-5 isoform X7 | ||||
Refseq | XP_020394058.1 | 0.0 | transcription factor MYB3R-5 isoform X7 | ||||
TrEMBL | A0A1D6H4Y8 | 0.0 | A0A1D6H4Y8_MAIZE; Myb-related protein 3R-1 | ||||
STRING | GRMZM2G073826_P01 | 0.0 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP14263 | 17 | 23 | Representative plant | OGRP12950 | 4 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G32730.2 | 2e-22 | Homeodomain-like protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G073826_P01 |