PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | GRMZM2G069370_P01 | ||||||||
Common Name | ZEAMMB73_580475, Zm.131337 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 199aa MW: 22894.4 Da PI: 8.4853 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 74.5 | 8.8e-24 | 10 | 56 | 2 | 48 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 rien rqvtf+kRr g+lKKA ELSvLCda + vi++s++gk+y+ GRMZM2G069370_P01 10 RIENPVHRQVTFCKRRMGLLKKARELSVLCDAAIGVIVISPHGKIYD 56 8********************************************97 PP | |||||||
2 | K-box | 56.5 | 1.2e-19 | 79 | 172 | 6 | 98 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 g+s +++++++ +qe+ L ei+ Lq+ R + Ge d++ ++l eLq Le++Le ++iRs+K++++ ++i+ l++ke lq n L++ GRMZM2G069370_P01 79 GESSNHNETQTIKQEVLALTHEIDLLQKGFRYMHGEnDINHMNLVELQTLENNLEMWANNIRSQKMQIISREIDMLRNKEAILQAVNGVLQE 170 56678899***************************978**************************************************9999 PP K-box 97 kl 98 ++ GRMZM2G069370_P01 171 RI 172 87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.16 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.2E-32 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.84E-26 | 1 | 73 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.28E-35 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 2.4E-24 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.4E-22 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-24 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.4E-24 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 8.3E-24 | 81 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 12.674 | 87 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0006310 | anatomy | tassel floret | ||||
PO:0006339 | anatomy | juvenile vascular leaf | ||||
PO:0006340 | anatomy | adult vascular leaf | ||||
PO:0006341 | anatomy | primary shoot system | ||||
PO:0006354 | anatomy | ear floret | ||||
PO:0006505 | anatomy | central spike of ear inflorescence | ||||
PO:0008018 | anatomy | transition vascular leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009054 | anatomy | inflorescence bract | ||||
PO:0009066 | anatomy | anther | ||||
PO:0009074 | anatomy | style | ||||
PO:0009084 | anatomy | pericarp | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020040 | anatomy | leaf base | ||||
PO:0020104 | anatomy | leaf sheath | ||||
PO:0020126 | anatomy | tassel inflorescence | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0020136 | anatomy | ear inflorescence | ||||
PO:0020142 | anatomy | stem internode | ||||
PO:0020148 | anatomy | shoot apical meristem | ||||
PO:0025142 | anatomy | leaf tip | ||||
PO:0025287 | anatomy | seedling coleoptile | ||||
PO:0025541 | anatomy | bundle sheath cell | ||||
PO:0025589 | anatomy | leaf lamina tip | ||||
PO:0001007 | developmental stage | pollen development stage | ||||
PO:0001009 | developmental stage | D pollen mother cell meiosis stage | ||||
PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
PO:0001053 | developmental stage | vascular leaf post-expansion stage | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0001094 | developmental stage | plant embryo coleoptilar stage | ||||
PO:0001095 | developmental stage | plant embryo true leaf formation stage | ||||
PO:0001180 | developmental stage | plant proembryo stage | ||||
PO:0007001 | developmental stage | early whole plant fruit ripening stage | ||||
PO:0007003 | developmental stage | IL.03 full inflorescence length reached stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage | ||||
PO:0007016 | developmental stage | whole plant flowering stage | ||||
PO:0007026 | developmental stage | FL.00 first flower(s) open stage | ||||
PO:0007031 | developmental stage | mid whole plant fruit ripening stage | ||||
PO:0007032 | developmental stage | whole plant fruit formation stage up to 10% | ||||
PO:0007045 | developmental stage | coleoptile emergence stage | ||||
PO:0007063 | developmental stage | LP.07 seven leaves visible stage | ||||
PO:0007065 | developmental stage | LP.05 five leaves visible stage | ||||
PO:0007072 | developmental stage | LP.18 eighteen leaves visible stage | ||||
PO:0007094 | developmental stage | LP.01 one leaf visible stage | ||||
PO:0007101 | developmental stage | LP.09 nine leaves visible stage | ||||
PO:0007104 | developmental stage | LP.15 fifteen leaves visible stage | ||||
PO:0007106 | developmental stage | LP.03 three leaves visible stage | ||||
PO:0007116 | developmental stage | LP.11 eleven leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007633 | developmental stage | endosperm development stage | ||||
PO:0021004 | developmental stage | inflorescence initiation stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KARELSVLCD AAIGVIVISP HGKIYDLATN 60 GNMQGLIERY RRACSEMHGE SSNHNETQTI KQEVLALTHE IDLLQKGFRY MHGENDINHM 120 NLVELQTLEN NLEMWANNIR SQKMQIISRE IDMLRNKEAI LQAVNGVLQE RIIEQNGILN 180 FSGTAMTPSQ LTMESNYYL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 1e-14 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
6byy_B | 1e-14 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
6byy_C | 1e-14 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
6byy_D | 1e-14 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | GRMZM2G069370 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves and spikelets (rice flower). {ECO:0000269|Ref.7}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | GRMZM2G069370_P01 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU976131 | 0.0 | EU976131.1 Zea mays clone 645550 hypothetical protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001145530.1 | 1e-146 | uncharacterized protein LOC100278959 | ||||
Swissprot | A2YQK9 | 2e-70 | MAD26_ORYSI; MADS-box transcription factor 26 | ||||
Swissprot | Q0J8G8 | 2e-70 | MAD26_ORYSJ; MADS-box transcription factor 26 | ||||
TrEMBL | K7UIP1 | 1e-145 | K7UIP1_MAIZE; Putative MADS-box transcription factor family protein | ||||
STRING | GRMZM2G069370_P01 | 1e-146 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1491 | 36 | 112 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71692.1 | 3e-57 | AGAMOUS-like 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | GRMZM2G069370_P01 |
Publications ? help Back to Top | |||
---|---|---|---|
|